GlyConnect

Export CSV

taxonomy (1) protein (19) source (6) structure (7) composition (1) disease (8) reference (22) site (35) peptide (12)

Taxonomy

Homo sapiens (Human)

Protein

Source

Reported structure

Composition

Hex:5 HexNAc:5 (avg mass : 1844.7023 )

Disease

Reference

Community Evaluation of Glycoproteomics Informatics Solutions Reveals High-Performance Search Strategies for Glycopeptide Analysis (2021 - Rebeca Kawahara, Kathirvel Alagesan, Marshall Bern, Meng Bo, Weiqian Cao, Robert J Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet-Weiland, Mingqi Liu, Yehia Mechref, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Vakhrushev, Christina Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Zhang Yong, Hui Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Goran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, and Morten Thaysen-Andersen) / Status : Reviewed
Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
A Microarray-Matrix-assisted Laser Desorption/Ionization-Mass Spectrometry Approach for Site-specific Protein N-glycosylation Analysis, as Demonstrated for Human Serum Immunoglobulin M (IgM) (2015 - Martin Pabst, Simon Karl Küster, Fabian Wahl, Jasmin Krismer, Petra S.Dittrich, Renato Zenobi) / Status : Reviewed
A Method for Comprehensive Glycosite-Mapping and Direct Quantitation of Serum Glycoproteins (2015 - Qiuting Hong, L. Renee Ruhaak, Carol Stroble, Evan Parker, Jincui Huang, Emanual Maverakis, Carlito B. Lebrilla) / Status : Reviewed
Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
Enrichment of glycopeptides for glycan structure and attachment site identification (2009 - Nilsson J, Rüetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G.) / Status : Reviewed
Differential Glycosylation of Polymeric and Monomeric IgA: A Possible Role in Glomerular Inflammation in IgA Nephropathy (2006 - Beatrijs D. Oortwijn, Anja Roos, Louise Royle, Daniëlle J. van Gijlswijk-Janssen, Maria C. Faber-Krol, Jan-Willem Eijgenraam, Raymond A. Dwek, Mohamed R. Daha, Pauline M. Rudd, Cees van Kooten) / Status : Reviewed
Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
Comparative study of the N-glycans of human monoclonal immunoglobulins M produced by hybridoma and parental cells. (2000 - Fukuta K, Abe R, Yokomatsu T, Kono N, Nagatomi Y, Asanagi M, Shimazaki Y, Makino T) / Status : Reviewed
Control of bisecting GlcNAc addition to N-linked sugar chains. (2000 - Fukuta K, Abe R, Yokomatsu T, Omae F, Asanagi M, Makino T) / Status : Reviewed
A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
Structures of the oligosaccharides present at the three asparagine-linked glycosylation sites of human IgD. (1983 - S J Mellis, J U Baenziger) / Status : Reviewed

Reported glycosite

Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
- Asn-144
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
- Undefined site
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
Immunoglobulin epsilon chain c region / Homo sapiens
- Undefined site
- Asn-21
- Asn-49
- Asn-99
- Asn-146
- Asn-252
Immunoglobulin gamma / Homo sapiens
- Undefined site
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
- Thr-109
- Asn-144
- Asn-340
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Asn-131
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
- Asn-367
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
- Asn-180
Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Asn-176
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
- Asn-227
- Asn-322
Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Asn-177
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
- Asn-46
- Asn-209
Immunoglobulin J chain / Homo sapiens
- Asn-71

Mass spectrometry observed peptide

ENISDPTSPLR (11aa)
- P01591 Asn-71 Immunoglobulin J chain / Homo sapiens
IIVPINNRENISDPTSPIR (19aa)
- P01591 Asn-71 Immunoglobulin J chain / Homo sapiens
HYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSPSCCHPR (38aa)
- P01876 Thr-109 Immunoglobulin heavy constant alpha 1 / Homo sapiens
RLSLHRPALEDLLLGSEANLTCTLTGLRD (29aa)
- P01876 Asn-144 Immunoglobulin heavy constant alpha 1 / Homo sapiens
LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- P01877 Asn-131 Immunoglobulin heavy constant alpha 2 / Homo sapiens
- P01876 Asn-144 Immunoglobulin heavy constant alpha 1 / Homo sapiens
EEQYNSTYR (9aa)
- P01857 Asn-180 Immunoglobulin heavy constant gamma 1 / Homo sapiens
EEQYNSTY (8aa)
- P01857 Asn-180 Immunoglobulin heavy constant gamma 1 / Homo sapiens
KTKPREEQYNSTYRV (15aa)
- P01857 Asn-180 Immunoglobulin heavy constant gamma 1 / Homo sapiens
GLTFQQNASSMCVPDQDTAIR (21aa)
- P01871 Asn-209 Immunoglobulin heavy constant mu / Homo sapiens
GITFQQNASSMCVPDQDTAIR (21aa)
- P01871 Asn-209 Immunoglobulin heavy constant mu / Homo sapiens
GFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSK (39aa)
- P01860 Asn-322 Immunoglobulin heavy constant gamma 3 / Homo sapiens
LAGKPTHVNVSVVMAEVDGTC (21aa)
- P01876 Asn-340 Immunoglobulin heavy constant alpha 1 / Homo sapiens

- N-Linked / Complex (avg mass : 1844.7023)
- N-Linked / Complex (avg mass : 1844.7023)
- N-Linked / Complex (avg mass : 1844.7023)
- N-Linked / Complex (avg mass : 1844.7023)
- N-Linked / Complex (avg mass : 1844.7023)
- N-Linked / Complex (avg mass : 1844.7023)
- N-Linked / Complex (avg mass : 1844.7023)