taxonomy (1)
protein (19)
source (6)
structure (7)
composition (1)
disease (8)
reference (22)
site (35)
peptide (12)
- Homo sapiens (Human)
Taxonomy
- Immunoglobulin alpha (non secretory) / Homo sapiens P01876 P01877
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens P0DOX2
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens P0DOX2
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens P0DOX2
- Immunoglobulin epsilon chain c region / Homo sapiens P01854
- Immunoglobulin gamma / Homo sapiens P01859 P01861 P01857 P01860
- Immunoglobulin gamma-1 heavy chain / Homo sapiens P0DOX5
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens P01877
- Immunoglobulin heavy constant delta / Homo sapiens P01880
- Immunoglobulin heavy constant gamma 1 / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 3 / Homo sapiens P01860
- Immunoglobulin heavy constant gamma 4 / Homo sapiens P01861
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Immunoglobulin J chain / Homo sapiens P01591
Protein
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Lymphocyte (CL_0000542)
- Cerebrospinal Fluid Secretion (GO_0033326)
Source
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 1147
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-?)Man(a1-3)[Gal(b1-4)GlcNAc(b1-?)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 1586
- N-Linked / Complex / Structure 2950
- N-Linked / Complex / Gal(b1-?)GlcNAc(b1-?)Man(a1-3)[Gal(b1-?)GlcNAc(b1-?)Man(a1-6)][GlcNAc(b1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 9474
Reported structure
- Hex:5 HexNAc:5 (avg mass : 1844.7023 )
Composition
- Cancer, breast (DOID:1612)
- Control/Healthy
- Gastritis (DOID:4029)
- Hyperimmune condition
- Hypersensitivity reaction disease (DOID:0060056)
- Multiple myeloma (DOID:9538)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- Systemic lupus erythematosus (DOID:9074)
Disease
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- A Microarray-Matrix-assisted Laser Desorption/Ionization-Mass Spectrometry Approach for Site-specific Protein N-glycosylation Analysis, as Demonstrated for Human Serum Immunoglobulin M (IgM) (2015 - Martin Pabst, Simon Karl Küster, Fabian Wahl, Jasmin Krismer, Petra S.Dittrich, Renato Zenobi) / Status : Reviewed
- A Method for Comprehensive Glycosite-Mapping and Direct Quantitation of Serum Glycoproteins (2015 - Qiuting Hong, L. Renee Ruhaak, Carol Stroble, Evan Parker, Jincui Huang, Emanual Maverakis, Carlito B. Lebrilla) / Status : Reviewed
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
- Enrichment of glycopeptides for glycan structure and attachment site identification (2009 - Nilsson J, Rüetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G.) / Status : Reviewed
- Differential Glycosylation of Polymeric and Monomeric IgA: A Possible Role in Glomerular Inflammation in IgA Nephropathy (2006 - Beatrijs D. Oortwijn, Anja Roos, Louise Royle, Daniëlle J. van Gijlswijk-Janssen, Maria C. Faber-Krol, Jan-Willem Eijgenraam, Raymond A. Dwek, Mohamed R. Daha, Pauline M. Rudd, Cees van Kooten) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
- Comparative study of the N-glycans of human monoclonal immunoglobulins M produced by hybridoma and parental cells. (2000 - Fukuta K, Abe R, Yokomatsu T, Kono N, Nagatomi Y, Asanagi M, Shimazaki Y, Makino T) / Status : Reviewed
- Control of bisecting GlcNAc addition to N-linked sugar chains. (2000 - Fukuta K, Abe R, Yokomatsu T, Omae F, Asanagi M, Makino T) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
- Structures of the oligosaccharides present at the three asparagine-linked glycosylation sites of human IgD. (1983 - S J Mellis, J U Baenziger) / Status : Reviewed
Reference
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
- Asn-144
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
- Immunoglobulin epsilon chain c region / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Asn-131
-
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
- Asn-367
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
- Asn-180
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
Reported glycosite
- ENISDPTSPLR (11aa)
- IIVPINNRENISDPTSPIR (19aa)
- HYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSPSCCHPR (38aa)
- RLSLHRPALEDLLLGSEANLTCTLTGLRD (29aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- EEQYNSTYR (9aa)
- EEQYNSTY (8aa)
- KTKPREEQYNSTYRV (15aa)
- GLTFQQNASSMCVPDQDTAIR (21aa)
- GITFQQNASSMCVPDQDTAIR (21aa)
- GFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSK (39aa)
- LAGKPTHVNVSVVMAEVDGTC (21aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 1844.7023)
- Control/Healthy
- Multiple myeloma (DOID:9538)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
- Structures of the oligosaccharides present at the three asparagine-linked glycosylation sites of human IgD. (1983 - S J Mellis, J U Baenziger) / Status : Reviewed
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
- Asn-367
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1844.7023)
- Control/Healthy
- Hyperimmune condition
- Hypersensitivity reaction disease (DOID:0060056)
- Systemic lupus erythematosus (DOID:9074)
- A Microarray-Matrix-assisted Laser Desorption/Ionization-Mass Spectrometry Approach for Site-specific Protein N-glycosylation Analysis, as Demonstrated for Human Serum Immunoglobulin M (IgM) (2015 - Martin Pabst, Simon Karl Küster, Fabian Wahl, Jasmin Krismer, Petra S.Dittrich, Renato Zenobi) / Status : Reviewed
- A Method for Comprehensive Glycosite-Mapping and Direct Quantitation of Serum Glycoproteins (2015 - Qiuting Hong, L. Renee Ruhaak, Carol Stroble, Evan Parker, Jincui Huang, Emanual Maverakis, Carlito B. Lebrilla) / Status : Reviewed
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
- Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
- Differential Glycosylation of Polymeric and Monomeric IgA: A Possible Role in Glomerular Inflammation in IgA Nephropathy (2006 - Beatrijs D. Oortwijn, Anja Roos, Louise Royle, Daniëlle J. van Gijlswijk-Janssen, Maria C. Faber-Krol, Jan-Willem Eijgenraam, Raymond A. Dwek, Mohamed R. Daha, Pauline M. Rudd, Cees van Kooten) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
- Asn-144
- Immunoglobulin epsilon chain c region / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
- Immunoglobulin J chain / Homo sapiens
- ENISDPTSPLR (11aa)
-
- N-Linked / Complex
(avg mass : 1844.7023)
- Lymphocyte (CL_0000542)
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1844.7023)
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1844.7023)
- Blood Serum (UBERON_0001977)
- Control/Healthy
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1844.7023)
- Lymphocyte (CL_0000542)
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1844.7023)
- Milk (UBERON_0001913)
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- RLSLHRPALEDLLLGSEANLTCTLTGLRD (29aa)
- KTKPREEQYNSTYRV (15aa)
-
- Hex:5 HexNAc:5 / N-Linked
(avg mass : 1844.7023)
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 1147
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-?)Man(a1-3)[Gal(b1-4)GlcNAc(b1-?)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 1586
- N-Linked / Complex / Structure 2950
- N-Linked / Complex / Gal(b1-?)GlcNAc(b1-?)Man(a1-3)[Gal(b1-?)GlcNAc(b1-?)Man(a1-6)][GlcNAc(b1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 9474
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- IIVPINNRENISDPTSPIR (19aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- EEQYNSTYR (9aa)
- EEQYNSTY (8aa)
- GLTFQQNASSMCVPDQDTAIR (21aa)
- GITFQQNASSMCVPDQDTAIR (21aa)
- GFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSK (39aa)
- LAGKPTHVNVSVVMAEVDGTC (21aa)
-
- Hex:5 HexNAc:5 / O-Linked
(avg mass : 1844.7023)
- Blood Serum (UBERON_0001977)
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- HYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSPSCCHPR (38aa)
Source
Suggested structure
Reported glycosite
Mass spectrometry observed peptide
- Hex:5 HexNAc:5 / O-Linked
(avg mass : 1844.7023)
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:5 HexNAc:5 / N-Linked
(avg mass : 1844.7023)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1844.7023)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1844.7023)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1844.7023)
Reported glycosite
- N-Linked / Complex
(avg mass : 1844.7023)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1844.7023)
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1844.7023)
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1844.7023)