Id Sequence Length Biological associations
1 LAGKPTHVNVSVV 13

    Reported structure

18 AGKPTHVNVSVVMAEVDGTCY 21

    Reported structure

49 GFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSK 39

    Reported structure

80 HYTNSSQDVTVPCR 14

    Reported structure

167 EEQYNSTYRVVSVLTVLHQDWLNGK 25

    Reported structure

239 HYTNSSQDVTVPCRVPPPPPCCHPR 25

    Reported structure

241 VFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQNVTAR 44

    Reported structure

295 EEQYNSTFR 9

    Reported structure

315 STGKPTLYNVSLVM 14
329 IGPGEPIEIICNVSGAIPPAGR 22

    Reported structure

363 AGKPTHVNVSV 11

    Reported structure

384 STGKPTLYNVSLVMSDTAGTC 21

    Reported structure

410 LAGKPTHVNVSVVMAE 16

    Reported structure

418 NASLVTYYTSSGEDILIGGLKPFTK 25

    Reported structure

419 GETASIICNISVR 13

    Reported structure

569 PALEDLLLGSEANLTCTLTGLR 22

    Reported structure

622 QVQIECVVINR 11

    Reported structure

672 EEQFNSTY 8

    Reported structure

687 DNANNSPYLQMNSLR 15

    Reported structure

772 ENISDPTSPLR 11
786 GLTFQQNASSMCVPDQDTAIR 21
897 TITIVENKPIQINCSVK 17

    Reported structure

947 LSLHRPALEDLLLGSEANLTCTL 23

    Reported structure

953 EEQFNSTFR 9
967 EEQFNSTYR 9

    Reported structure

989 TLLNASR 7

    Reported structure

1004 ASQNISSWLAWYQQK 15

    Reported structure

1121 EEQFNSTF 8

    Reported structure

1220 LAGKPTHVNVSVVMAEVDGTC 21

    Reported structure

1399 SATVNLTVIR 10

    Reported structure

1434 SLDLSHNLISDFAWSDLHNLSALQLLK 27

    Reported structure

1519 NNSDISSTR 9
1553 GLTFQQNASSMCGPDQDTAIR 21

    Reported structure

1606 IIVPINNRENISDPTSPIR 19

    Reported structure

1703 TPLTANITK 9
1715 GNETQLMLNSLQPNK 15

    Reported structure

1732 VQGFFPQEPLSVTWSESGQNVTAR 24

    Reported structure

1758 LAGKPTHVNVSVVM 14

    Reported structure

1769 IAGKPTHVNVSVVMAEVDGTCY 22

    Reported structure

1786 GITFQQNASSMCVPDQDTAIR 21

    Reported structure

1794 LAGKPTHVNVSV 12

    Reported structure

1852 TKPREEQYNSTY 12

    Reported structure

1898 TKPREEQFNSTF 12

    Reported structure

1960 YKNNSDISSTR 11
2040 LSLHRPALEDLLLGSEANLTCTLTGLR 27
2044 FQAFANGSLLIPDFGK 16

    Reported structure

2073 MAGKPTHINVSVVMAEADGTCY 22

    Reported structure

2367 LAGKPTHVNVS 11

    Reported structure

2381 STGKPTLYNVSLVMSDTAGTCY 22

    Reported structure

2414 TIDRLAGKPTHVNVSVVMAEVDGTCY 26

    Reported structure