Id Sequence Length Biological associations
29 ANGTTHLVVTEPTR 14

    Reported structure

    Disease

40 LNLTTDPK 8

    Reported structure

    Disease

105 NETHFDAGAK 10

    Reported structure

    Disease

110 FFNFSWR 7

    Reported structure

    Disease

124 SCINESAIDSR 11

    Protein

  • Neprilysin / Mus musculus    Q61391

    Reported structure

    Disease

137 FINYNQTVSR 10

    Reported structure

    Disease

177 YHYNGTFEDGK 11

    Reported structure

    Disease

246 CDMDGQNR 8

    Reported structure

    Disease

247 SMVDFMNTDNFTSHR 15

    Protein

  • Noelin / Mus musculus    O88998

    Reported structure

    Disease

253 IHGQELPFEAVVLNK 15

    Reported structure

    Disease

259 FNSTEYQVVTR 11

    Reported structure

    Disease

289 LVVNISDLGYPK 12

    Reported structure

    Disease

291 SSPDTQDLYCLNESSK 16

    Reported structure

    Disease

293 NPEAPLNVSR 10

    Reported structure

    Disease

332 VHINTTSDSILLK 13

    Reported structure

    Disease

336 NFSSCSAEDFEK 12

    Reported structure

    Disease

365 ANITVK 6

    Reported structure

    Disease

380 INSTEAR 7

    Reported structure

    Disease

385 EEEAIQLDGLNASQIR 16

    Reported structure

    Disease

447 ANATIEVK 8

    Reported structure

    Disease

544 HNLTITQGK 9

    Reported structure

    Disease

558 DNTTCYEFKK 10

    Reported structure

    Disease

581 NLTIVDSGLK 10

    Reported structure

    Disease

651 EADNHTAFIR 10

    Reported structure

    Disease

658 KNASNMEYR 9

    Reported structure

    Disease

682 IDSTGNVTNELR 12

    Protein

  • Attractin / Mus musculus    Q9WU60

    Reported structure

    Disease

693 NISQVLEK 8

    Reported structure

    Disease

703 VVRPDSELGERPPEDNQSFQYDHEAFLGKEDSK 33

    Reported structure

    Disease

714 TCVSNCTASQFVCK 14

    Reported structure

    Disease

717 SYNDSVDPR 9

    Reported structure

    Disease

754 GPGIKPNQTSK 11

    Reported structure

    Disease

771 VGYQSQNISCFFR 13

    Reported structure

    Disease

775 ANATLLLGPLR 11

    Reported structure

    Disease

781 VQNMSQSIEVLDR 13

    Protein

  • Noelin / Mus musculus    O88998

    Reported structure

    Disease

820 MHLNGSNVQVLHR 13

    Reported structure

    Disease

842 DQPGHPVNR 9

    Reported structure

    Disease

882 NISSEEK 7

    Reported structure

    Disease

894 VFIVPVGNHSNIPFSR 16

    Reported structure

    Disease

905 AQAALDKANASR 12

    Reported structure

    Disease

907 VNNGPLGNPIWNISGDPTR 19

    Reported structure

    Disease

961 TPASDPHGDNLTYSVFYTK 19

    Reported structure

    Disease

985 ADGSFRLENITTGTYTIHAQK 21

    Reported structure

    Disease

988 IETILLNGTDR 11

    Reported structure

    Disease

1009 CHEGNGTFECGACR 14

    Reported structure

    Disease

1048 SIVLEPIYWNSSNSK 15

    Protein

  • Ephrin-B2 / Mus musculus    P52800

    Reported structure

    Disease

1055 YNQETPMEICLNGTPALAYLASAPPPLCPSGR 32

    Reported structure

    Disease

1113 EGSRTDDEVVQREEEAIQLDGLNASQIR 28

    Reported structure

    Disease

1120 NLSGPDKR 8

    Protein

  • Vasorin / Mus musculus    Q9CZT5

    Reported structure

    Disease

1130 IINVTK 6

    Reported structure

    Disease

1173 DAGVGFPEYQEEDNSTYNFR 20

    Reported structure

    Disease