taxonomy (1)
protein (1)
source (2)
structure (1)
composition (1)
disease (0)
reference (2)
site (1)
peptide (1)
- Homo sapiens (Human)
Taxonomy
- HEK293 (CVCL_0045)
- HeLa (CVCL_0030)
Source
- O-Linked / O-GlcNAc / GlcNAc(b
Reported structure
- HexNAc:1 (avg mass : 221.2103 )
Composition
Disease
- Electron Transfer Dissociation (ETD): The Mass Spectrometric Breakthrough Essential for O-GlcNAc Protein Site Assignments-A Study of the O-GlcNAcylated Protein Host Cell Factor C1 (2013 - Samuel A Myers, Salima Daou, El Bachir Affar, Al Burlingame) / Status : Reviewed
- Extensive Crosstalk Between O-GlcNAcylation and Phosphorylation Regulates Cytokinesis (2010 - Zihao Wang, Namrata D Udeshi, Chad Slawson, Philip D Compton, Kaoru Sakabe, Win D Cheung, Jeffrey Shabanowitz, Donald F Hunt, Gerald W Hart) / Status : Reviewed
Reference
- Host Cell Factor 1 / Homo sapiens
Reported glycosite
- VMSVVQTKPVQTSAVTGQASTGPVTQIIQTK (31aa)
Mass spectrometry observed peptide
-
- O-Linked / O-GlcNAc
(avg mass : 221.2103)
- HEK293 (CVCL_0045)
- HeLa (CVCL_0030)
- Electron Transfer Dissociation (ETD): The Mass Spectrometric Breakthrough Essential for O-GlcNAc Protein Site Assignments-A Study of the O-GlcNAcylated Protein Host Cell Factor C1 (2013 - Samuel A Myers, Salima Daou, El Bachir Affar, Al Burlingame) / Status : Reviewed
- Extensive Crosstalk Between O-GlcNAcylation and Phosphorylation Regulates Cytokinesis (2010 - Zihao Wang, Namrata D Udeshi, Chad Slawson, Philip D Compton, Kaoru Sakabe, Win D Cheung, Jeffrey Shabanowitz, Donald F Hunt, Gerald W Hart) / Status : Reviewed
- Host Cell Factor 1 / Homo sapiens
- VMSVVQTKPVQTSAVTGQASTGPVTQIIQTK (31aa)
Source
Reference
Reported glycosite
Mass spectrometry observed peptide
- O-Linked / O-GlcNAc
(avg mass : 221.2103)