Id Sequence Length Biological associations
4979 DFGGFNFSQILPDPSK 16
4983 EGVFVSNGTHWFVTQR 16
4992 KNFTTAPAICHDGK 14
5002 VYSSANNCTFEYVSQPFLMDLEGK 24
5013 GVFVSNGTHWFVTQR 15
5035 TQSLLIVNNATNVVIK 16
5390 HAIHVSGTNGTKRF 14
5579 FGGFNFSQILPDPSKPSKR 19
5758 FSNVTWFHAIHVSGTNGTK 19
5774 VTWFHAIHVSGTNGTK 16
5866 FGGFNFSQILPDPSKPSK 18
5879 IVNNATNVVIKVCEF 15
6084 HAIHVSGTNGTK 12
6437 EGVFVSNGTHW 11
6491 NFSQILPDPSKPS 13
6503 RVQPTESIVRFPNITNLCPF 20
6620 NFSQILPDPSKPSKR 15
6926 RVQPTESIVRFPNITNL 17
7009 FHAIHVSGTNGTKRF 15
7019 YHKNNKSWMESEF 13
7235 LAGTVPSTVALLPSTATE 18

    Disease

7236 ATFAFGAQTSTTADQGAAK 19

    Disease

7237 DVSSVELLMK 10

    Disease

7238 AVVPVSK 7

    Disease

7239 PQATSAPSPAPK 12

    Disease

7240 EQDQSFTALD 10

    Disease

7241 VGSPATVTFQQNK 13

    Disease

7242 VSTSGPR 7

    Disease

7243 AQPSVSLGAAYR 12

    Disease

7244 HSHAVSTAAMTR 12

    Disease

7245 SSSQTSGSLVSK 12

    Disease

7246 VMSVVQTKPVQTSAVTGQASTGPVTQIIQTK 31
7247 IVNVSLADLR 10

    Disease

7248 TSSEASVSSSVAK 13

    Disease

7249 ASSTSLTSTQPTK 13

    Disease

7250 PATAAVPTSQSVK 13

    Disease

7251 AQPPSSAASR 10

    Disease

7252 STAPAVAYDSK 11

    Disease

7253 GTVQTSVDTTK 11

    Disease

7254 PSFPPSTSAVK 11

    Disease

7255 TPTSQSYR 8

    Disease

7256 PQTSGAYVLNK 11

    Disease

7257 VITSQAGK 8

    Disease

7258 ILDSFAAAPVPTTTLVLK 18

    Disease

7259 MFLSFPTTK 9

    Disease

7260 ISEILLDHGAPIQAK 15

    Protein

  • Ankyrin-1 / Homo sapiens    P16157

    Disease

7261 VVTDETSFVLVSDK 14

    Protein

  • Ankyrin-1 / Homo sapiens    P16157

    Disease

7262 ASTPGAAAQIQEVK 14

    Disease

7263 AGVSTNISTK 10

    Disease

7264 SVSSSSYR 8

    Protein

  • Vimentin / Homo sapiens    P08670

    Disease