taxonomy (1)
protein (1)
source (6)
structure (52)
composition (73)
disease (4)
reference (12)
site (6)
peptide (15)
- Homo sapiens (Human)
Taxonomy
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Colostrum (UBERON_0001914)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Urine (UBERON_0001088)
Source
- N-Linked / Complex / Structure 10940
- N-Linked / Complex / Structure 10950
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 2643
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 10924
- N-Linked / Complex / Structure 10933
- N-Linked / Complex / Structure 2888
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10553
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10951
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10049
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10917
- N-Linked / Complex / Structure 10916
- N-Linked / Complex / Structure 10499
- N-Linked / Complex / Structure 10887
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 3446
- N-Linked / Complex / Structure 1523
- N-Linked / Complex / Structure 10184
- N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-6)[Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10947
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 1149
- N-Linked / Complex / Structure 10910
- N-Linked / Complex / Structure 10899
- N-Linked / Complex / Neu?c(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Neu?c(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 1519
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 10957
- N-Linked / Complex / Structure 10931
- N-Linked / Complex / Structure 350
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10932
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Hybrid / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 9746
Reported structure
- Hex:3 HexNAc:2 (avg mass : 910.8325 )
- Hex:3 HexNAc:2 dHex:1 (avg mass : 1056.9755 )
- Hex:3 HexNAc:3 (avg mass : 1114.0275 )
- Hex:3 HexNAc:3 NeuAc:1 (avg mass : 1405.2854 )
- Hex:3 HexNAc:3 dHex:1 (avg mass : 1260.1705 )
- Hex:3 HexNAc:4 (avg mass : 1317.2225 )
- Hex:3 HexNAc:4 dHex:1 (avg mass : 1463.3655 )
- Hex:3 HexNAc:5 (avg mass : 1520.4175 )
- Hex:3 HexNAc:5 dHex:1 (avg mass : 1666.5605 )
- Hex:3 HexNAc:6 dHex:2 NeuAc:1 (avg mass : 2307.1564 )
- Hex:3 HexNAc:6 dHex:3 (avg mass : 2162.0415 )
- Hex:4 HexNAc:3 (avg mass : 1276.1699 )
- Hex:4 HexNAc:3 NeuAc:1 (avg mass : 1567.4278 )
- Hex:4 HexNAc:3 dHex:1 (avg mass : 1422.3129 )
- Hex:4 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 1713.5708 )
- Hex:4 HexNAc:4 (avg mass : 1479.3649 )
- Hex:4 HexNAc:4 NeuAc:1 (avg mass : 1770.6228 )
- Hex:4 HexNAc:4 NeuAc:2 (avg mass : 2061.8807 )
- Hex:4 HexNAc:4 dHex:1 (avg mass : 1625.5079 )
- Hex:4 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 1916.7658 )
- Hex:4 HexNAc:4 dHex:2 NeuAc:1 (avg mass : 2062.9088 )
- Hex:4 HexNAc:5 (avg mass : 1682.5599 )
- Hex:4 HexNAc:5 NeuAc:1 (avg mass : 1973.8178 )
- Hex:4 HexNAc:5 NeuAc:1 NeuGc:1 (avg mass : 2281.0751 )
- Hex:4 HexNAc:5 dHex:1 (avg mass : 1828.7029 )
- Hex:4 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2119.9608 )
- Hex:4 HexNAc:5 dHex:2 NeuAc:1 (avg mass : 2266.1038 )
- Hex:4 HexNAc:6 dHex:1 (avg mass : 2031.8979 )
- Hex:4 HexNAc:7 dHex:1 (avg mass : 2235.0929 )
- Hex:5 HexNAc:2 (avg mass : 1235.1173 )
- Hex:5 HexNAc:3 (avg mass : 1438.3123 )
- Hex:5 HexNAc:3 NeuAc:1 (avg mass : 1729.5702 )
- Hex:5 HexNAc:4 (avg mass : 1641.5073 )
- Hex:5 HexNAc:4 NeuAc:1 (avg mass : 1932.7652 )
- Hex:5 HexNAc:4 NeuAc:2 (avg mass : 2224.0231 )
- Hex:5 HexNAc:4 NeuAc:2 Su:1 (avg mass : 2304.0873 )
- Hex:5 HexNAc:4 dHex:1 (avg mass : 1787.6503 )
- Hex:5 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 2078.9082 )
- Hex:5 HexNAc:4 dHex:1 NeuAc:2 (avg mass : 2370.1661 )
- Hex:5 HexNAc:4 dHex:1 NeuAc:2 Su:1 (avg mass : 2450.2303 )
- Hex:5 HexNAc:4 dHex:2 NeuAc:1 (avg mass : 2225.0512 )
- Hex:5 HexNAc:4 dHex:3 (avg mass : 2079.9363 )
- Hex:5 HexNAc:5 (avg mass : 1844.7023 )
- Hex:5 HexNAc:5 NeuAc:1 (avg mass : 2135.9602 )
- Hex:5 HexNAc:5 NeuAc:2 (avg mass : 2427.2181 )
- Hex:5 HexNAc:5 dHex:1 (avg mass : 1990.8453 )
- Hex:5 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2282.1032 )
- Hex:5 HexNAc:5 dHex:1 NeuAc:2 (avg mass : 2573.3611 )
- Hex:5 HexNAc:5 dHex:2 (avg mass : 2136.9883 )
- Hex:5 HexNAc:5 dHex:2 NeuAc:1 (avg mass : 2428.2462 )
- Hex:5 HexNAc:6 (avg mass : 2047.8973 )
- Hex:5 HexNAc:6 dHex:2 (avg mass : 2340.1833 )
- Hex:5 HexNAc:7 dHex:1 (avg mass : 2397.2353 )
- Hex:6 HexNAc:2 (avg mass : 1397.2597 )
- Hex:6 HexNAc:3 NeuAc:1 (avg mass : 1891.7126 )
- Hex:6 HexNAc:3 dHex:1 (avg mass : 1746.5977 )
- Hex:6 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 2037.8556 )
- Hex:6 HexNAc:4 dHex:1 (avg mass : 1949.7927 )
- Hex:6 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 2241.0506 )
- Hex:6 HexNAc:4 dHex:2 (avg mass : 2095.9357 )
- Hex:6 HexNAc:5 NeuAc:1 (avg mass : 2298.1026 )
- Hex:6 HexNAc:5 NeuAc:2 (avg mass : 2589.3605 )
- Hex:6 HexNAc:5 NeuAc:3 (avg mass : 2880.6184 )
- Hex:6 HexNAc:5 dHex:1 (avg mass : 2152.9877 )
- Hex:6 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2444.2456 )
- Hex:6 HexNAc:5 dHex:2 (avg mass : 2299.1307 )
- Hex:7 HexNAc:2 (avg mass : 1559.4021 )
- Hex:7 HexNAc:4 (avg mass : 1965.7921 )
- Hex:7 HexNAc:4 NeuAc:1 (avg mass : 2257.05 )
- Hex:7 HexNAc:4 dHex:1 (avg mass : 2111.9351 )
- Hex:8 HexNAc:2 (avg mass : 1721.5445 )
- Hex:9 HexNAc:2 (avg mass : 1883.6869 )
- Hex:12 HexNAc:2 (avg mass : 2370.1141 )
Composition
- Cancer, breast (DOID:1612)
- Control/Healthy
- Myeloma, Multiple (DOID:9538)
- Prostate cancer (DOID:10283)
Disease
- Community Evaluation of Glycoproteomics Informatics Solutions Reveals High-Performance Search Strategies for Glycopeptide Analysis (2021 - Rebeca Kawahara, Kathirvel Alagesan, Marshall Bern, Meng Bo, Weiqian Cao, Robert J Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet-Weiland, Mingqi Liu, Yehia Mechref, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Vakhrushev, Christina Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Zhang Yong, Hui Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Goran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, and Morten Thaysen-Andersen) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- A Method for Comprehensive Glycosite-Mapping and Direct Quantitation of Serum Glycoproteins (2015 - Qiuting Hong, L. Renee Ruhaak, Carol Stroble, Evan Parker, Jincui Huang, Emanual Maverakis, Carlito B. Lebrilla) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Comparison of sialylated N-glycopeptide levels in serum of pancreatic cancer patients, acute pancreatitis patients, and healthy controls (2014 - Kontro H, Joenväärä S, Haglund C, Renkonen R) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- GlycoSpectrumScan: Fishing Glycopeptides from MS Spectra of Protease Digests of Human Colostrum sIgA (2010 - Nandan Deshpande, Pia H. Jensen, Nicolle H. Packer, Daniel Kolarich) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
Reference
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
Reported glycosite
- VQGFFPQEPLSVTWSESGQNVTAR (24aa)
- SVTWSESGQNVTAR (14aa)
- VFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQNVTAR (44aa)
- LVQGFFPQEPLSVTWSESGQNVTAR (25aa)
- HYTNSSQDVTVPCRVPPPPPCCHPR (25aa)
- HYTNSSQDVTVPCR (14aa)
- LSLHRPALEDLLLGSEANLTCTL (23aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- PALEDLLLGSEANLTCTLTGLR (22aa)
- TPLTANITK (9aa)
- KTPLTANITKS (11aa)
- AGKPTHVNVSV (11aa)
- MAGKPTHVNVSVVMAEVDGTCY (22aa)
- AGKPTHVNVSVVMAEVDGTCY (21aa)
- MAGKPTHINVSVVMAEADGTCY (22aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 1405.2854)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1405.2854)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1422.3129)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1422.3129)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1463.3655)
- Milk (UBERON_0001913)
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- KTPLTANITKS (11aa)
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1520.4175)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1567.4278)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1567.4278)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1625.5079)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Colostrum (UBERON_0001914)
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- TPLTANITK (9aa)
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1682.5599)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1682.5599)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1713.5708)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1713.5708)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1770.6228)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1770.6228)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1787.6503)
- Blood Serum (UBERON_0001977)
- Control/Healthy
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1787.6503)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1787.6503)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1828.7029)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1828.7029)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1828.7029)
- Control/Healthy
- A Method for Comprehensive Glycosite-Mapping and Direct Quantitation of Serum Glycoproteins (2015 - Qiuting Hong, L. Renee Ruhaak, Carol Stroble, Evan Parker, Jincui Huang, Emanual Maverakis, Carlito B. Lebrilla) / Status : Reviewed
- GlycoSpectrumScan: Fishing Glycopeptides from MS Spectra of Protease Digests of Human Colostrum sIgA (2010 - Nandan Deshpande, Pia H. Jensen, Nicolle H. Packer, Daniel Kolarich) / Status : Reviewed
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- TPLTANITK (9aa)
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1844.7023)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1916.7658)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1916.7658)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1932.7652)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1973.8178)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1973.8178)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1990.8453)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1990.8453)
- Blood Serum (UBERON_0001977)
- Control/Healthy
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2078.9082)
- Blood Serum (UBERON_0001977)
- Control/Healthy
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2078.9082)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2079.9363)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2135.9602)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2224.0231)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2282.1032)
- Blood Serum (UBERON_0001977)
- Control/Healthy
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2282.1032)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2304.0873)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2370.1661)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2370.1661)
- Blood Serum (UBERON_0001977)
- Control/Healthy
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2427.2181)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2428.2462)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2450.2303)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2573.3611)
- Blood Serum (UBERON_0001977)
- Control/Healthy
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2573.3611)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2589.3605)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Hybrid
(avg mass : 1746.5977)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1891.7126)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- N-Linked / Hybrid
(avg mass : 2037.8556)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
- Hex:3 HexNAc:2 / N-Linked
(avg mass : 910.8325)
- Mammary Gland (UBERON_0001911)
- Cancer, breast (DOID:1612)
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
-
- Hex:3 HexNAc:2 dHex:1 / N-Linked
(avg mass : 1056.9755)
- Cancer, breast (DOID:1612)
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- TPLTANITK (9aa)
-
- Hex:3 HexNAc:3 / N-Linked
(avg mass : 1114.0275)
- Mammary Gland (UBERON_0001911)
- Cancer, breast (DOID:1612)
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
-
- Hex:5 HexNAc:2 / N-Linked
(avg mass : 1235.1173)
- Cancer, breast (DOID:1612)
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- AGKPTHVNVSVVMAEVDGTCY (21aa)
- MAGKPTHINVSVVMAEADGTCY (22aa)
-
- Hex:3 HexNAc:3 dHex:1 / N-Linked
(avg mass : 1260.1705)
- Mammary Gland (UBERON_0001911)
- Cancer, breast (DOID:1612)
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- TPLTANITK (9aa)
-
- Hex:4 HexNAc:3 / N-Linked
(avg mass : 1276.1699)
- Blood Serum (UBERON_0001977)
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- MAGKPTHINVSVVMAEADGTCY (22aa)
-
- Hex:3 HexNAc:4 / N-Linked
(avg mass : 1317.2225)
- Mammary Gland (UBERON_0001911)
- Cancer, breast (DOID:1612)
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- TPLTANITK (9aa)
-
- Hex:6 HexNAc:2 / N-Linked
(avg mass : 1397.2597)
- Mammary Gland (UBERON_0001911)
- Cancer, breast (DOID:1612)
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- TPLTANITK (9aa)
- MAGKPTHINVSVVMAEADGTCY (22aa)
-
- Hex:5 HexNAc:3 / N-Linked
(avg mass : 1438.3123)
- Mammary Gland (UBERON_0001911)
- Cancer, breast (DOID:1612)
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
-
- Hex:3 HexNAc:4 dHex:1 / N-Linked
(avg mass : 1463.3655)
- N-Linked / Complex / Structure 2643
- Cancer, breast (DOID:1612)
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- HYTNSSQDVTVPCR (14aa)
- TPLTANITK (9aa)
-
- Hex:4 HexNAc:4 / N-Linked
(avg mass : 1479.3649)
- Mammary Gland (UBERON_0001911)
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- Cancer, breast (DOID:1612)
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
-
- Hex:3 HexNAc:5 / N-Linked
(avg mass : 1520.4175)
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- Cancer, breast (DOID:1612)
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- TPLTANITK (9aa)
-
- Hex:7 HexNAc:2 / N-Linked
(avg mass : 1559.4021)
- Mammary Gland (UBERON_0001911)
- Cancer, breast (DOID:1612)
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- TPLTANITK (9aa)
-
- Hex:4 HexNAc:3 NeuAc:1 / N-Linked
(avg mass : 1567.4278)
- Mammary Gland (UBERON_0001911)
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 10924
- Cancer, breast (DOID:1612)
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
-
- Hex:4 HexNAc:4 dHex:1 / N-Linked
(avg mass : 1625.5079)
- N-Linked / Complex / Structure 10933
- Cancer, breast (DOID:1612)
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- TPLTANITK (9aa)
-
- Hex:5 HexNAc:4 / N-Linked
(avg mass : 1641.5073)
- Mammary Gland (UBERON_0001911)
- Cancer, breast (DOID:1612)
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
-
- Hex:3 HexNAc:5 dHex:1 / N-Linked
(avg mass : 1666.5605)
- N-Linked / Complex / Structure 2888
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- HYTNSSQDVTVPCR (14aa)
- HYTNSSQDVTVPCRVPPPPPCCHPR (25aa)
- TPLTANITK (9aa)
-
- Hex:4 HexNAc:5 / N-Linked
(avg mass : 1682.5599)
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- Cancer, breast (DOID:1612)
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- TPLTANITK (9aa)
-
- Hex:4 HexNAc:3 dHex:1 NeuAc:1 / N-Linked
(avg mass : 1713.5708)
- Blood Serum (UBERON_0001977)
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10553
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- TPLTANITK (9aa)
-
- Hex:8 HexNAc:2 / N-Linked
(avg mass : 1721.5445)
- Mammary Gland (UBERON_0001911)
- Cancer, breast (DOID:1612)
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- TPLTANITK (9aa)
-
- Hex:5 HexNAc:3 NeuAc:1 / N-Linked
(avg mass : 1729.5702)
- Cancer, breast (DOID:1612)
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
-
- Hex:4 HexNAc:4 NeuAc:1 / N-Linked
(avg mass : 1770.6228)
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- Cancer, breast (DOID:1612)
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
-
- Hex:5 HexNAc:4 dHex:1 / N-Linked
(avg mass : 1787.6503)
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10951
- Cancer, breast (DOID:1612)
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- SVTWSESGQNVTAR (14aa)
- HYTNSSQDVTVPCR (14aa)
- TPLTANITK (9aa)
-
- Hex:4 HexNAc:5 dHex:1 / N-Linked
(avg mass : 1828.7029)
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10049
- Cancer, breast (DOID:1612)
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- LSLHRPALEDLLLGSEANLTCTL (23aa)
- TPLTANITK (9aa)
-
- Hex:5 HexNAc:5 / N-Linked
(avg mass : 1844.7023)
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- Cancer, breast (DOID:1612)
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
-
- Hex:9 HexNAc:2 / N-Linked
(avg mass : 1883.6869)
- Mammary Gland (UBERON_0001911)
- Cancer, breast (DOID:1612)
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
-
- Hex:6 HexNAc:3 NeuAc:1 / N-Linked
(avg mass : 1891.7126)
- N-Linked / Hybrid / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- Cancer, breast (DOID:1612)
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
-
- Hex:4 HexNAc:4 dHex:1 NeuAc:1 / N-Linked
(avg mass : 1916.7658)
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10917
- Cancer, breast (DOID:1612)
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- TPLTANITK (9aa)
-
- Hex:5 HexNAc:4 NeuAc:1 / N-Linked
(avg mass : 1932.7652)
- N-Linked / Complex / Structure 10916
- Cancer, breast (DOID:1612)
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Comparison of sialylated N-glycopeptide levels in serum of pancreatic cancer patients, acute pancreatitis patients, and healthy controls (2014 - Kontro H, Joenväärä S, Haglund C, Renkonen R) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- PALEDLLLGSEANLTCTLTGLR (22aa)
- TPLTANITK (9aa)
- MAGKPTHVNVSVVMAEVDGTCY (22aa)
-
- Hex:6 HexNAc:4 dHex:1 / N-Linked
(avg mass : 1949.7927)
- Hex:6 HexNAc:4 dHex:1 / N-Linked
(avg mass : 1949.7927)
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:5 HexNAc:4 NeuAc:1 / N-Linked
(avg mass : 1932.7652)
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:4 HexNAc:4 dHex:1 NeuAc:1 / N-Linked
(avg mass : 1916.7658)
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:6 HexNAc:3 NeuAc:1 / N-Linked
(avg mass : 1891.7126)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:9 HexNAc:2 / N-Linked
(avg mass : 1883.6869)
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:5 HexNAc:5 / N-Linked
(avg mass : 1844.7023)
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:4 HexNAc:5 dHex:1 / N-Linked
(avg mass : 1828.7029)
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:5 HexNAc:4 dHex:1 / N-Linked
(avg mass : 1787.6503)
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:4 HexNAc:4 NeuAc:1 / N-Linked
(avg mass : 1770.6228)
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:5 HexNAc:3 NeuAc:1 / N-Linked
(avg mass : 1729.5702)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:8 HexNAc:2 / N-Linked
(avg mass : 1721.5445)
Source
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:4 HexNAc:3 dHex:1 NeuAc:1 / N-Linked
(avg mass : 1713.5708)
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:4 HexNAc:5 / N-Linked
(avg mass : 1682.5599)
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:3 HexNAc:5 dHex:1 / N-Linked
(avg mass : 1666.5605)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:5 HexNAc:4 / N-Linked
(avg mass : 1641.5073)
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:4 HexNAc:4 dHex:1 / N-Linked
(avg mass : 1625.5079)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:4 HexNAc:3 NeuAc:1 / N-Linked
(avg mass : 1567.4278)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:7 HexNAc:2 / N-Linked
(avg mass : 1559.4021)
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:3 HexNAc:5 / N-Linked
(avg mass : 1520.4175)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:4 HexNAc:4 / N-Linked
(avg mass : 1479.3649)
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:3 HexNAc:4 dHex:1 / N-Linked
(avg mass : 1463.3655)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:5 HexNAc:3 / N-Linked
(avg mass : 1438.3123)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:6 HexNAc:2 / N-Linked
(avg mass : 1397.2597)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:3 HexNAc:4 / N-Linked
(avg mass : 1317.2225)
Source
Suggested structure
Reported glycosite
Mass spectrometry observed peptide
- Hex:4 HexNAc:3 / N-Linked
(avg mass : 1276.1699)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:3 HexNAc:3 dHex:1 / N-Linked
(avg mass : 1260.1705)
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:5 HexNAc:2 / N-Linked
(avg mass : 1235.1173)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:3 HexNAc:3 / N-Linked
(avg mass : 1114.0275)
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:3 HexNAc:2 dHex:1 / N-Linked
(avg mass : 1056.9755)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:3 HexNAc:2 / N-Linked
(avg mass : 910.8325)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Hybrid
(avg mass : 2037.8556)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Hybrid
(avg mass : 1891.7126)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Hybrid
(avg mass : 1746.5977)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2589.3605)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2573.3611)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2573.3611)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2450.2303)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2428.2462)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2427.2181)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2370.1661)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2370.1661)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2304.0873)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2282.1032)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2282.1032)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2224.0231)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2135.9602)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2079.9363)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2078.9082)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2078.9082)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1990.8453)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1990.8453)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1973.8178)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1973.8178)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1932.7652)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1844.7023)
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
Suggested glycosite
- N-Linked / Complex
(avg mass : 1828.7029)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1828.7029)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1828.7029)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1787.6503)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1787.6503)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1787.6503)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1770.6228)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1770.6228)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1713.5708)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1713.5708)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1682.5599)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1682.5599)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reported glycosite
Mass spectrometry observed peptide
Suggested glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1625.5079)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1567.4278)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1567.4278)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1520.4175)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1479.3649)
Source
Reported glycosite
Mass spectrometry observed peptide
Suggested glycosite
- N-Linked / Complex
(avg mass : 1463.3655)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1422.3129)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1422.3129)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1405.2854)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1405.2854)