taxonomy (1)
protein (1)
source (3)
structure (36)
composition (22)
disease (5)
reference (5)
site (6)
peptide (4)
- Homo sapiens (Human)
Taxonomy
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(?1-?)Man(a1-3)[GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 2643
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 2011
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 10152
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 2719
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 2888
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 2104
- N-Linked / Complex / Structure 231
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10049
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 1147
- N-Linked / Complex / Structure 908
- N-Linked / Complex / Structure 3507
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 3446
- N-Linked / Complex / Structure 1523
- O-Linked / Core 1 / Gal(b1-3)GalNAc
- O-Linked / Core 1 / Gal(b1-3)GalNAc(a + "Neu5Ac(a"
- O-Linked / Core 1 / Structure 10127
Reported structure
- Hex:1 HexNAc:1 (avg mass : 383.3527 )
- Hex:1 HexNAc:1 NeuAc:1 (avg mass : 674.6106 )
- Hex:1 HexNAc:1 NeuAc:2 (avg mass : 965.8685 )
- Hex:3 HexNAc:3 dHex:1 (avg mass : 1260.1705 )
- Hex:3 HexNAc:4 (avg mass : 1317.2225 )
- Hex:3 HexNAc:4 dHex:1 (avg mass : 1463.3655 )
- Hex:3 HexNAc:5 (avg mass : 1520.4175 )
- Hex:3 HexNAc:5 dHex:1 (avg mass : 1666.5605 )
- Hex:4 HexNAc:3 (avg mass : 1276.1699 )
- Hex:4 HexNAc:3 dHex:1 (avg mass : 1422.3129 )
- Hex:4 HexNAc:4 (avg mass : 1479.3649 )
- Hex:4 HexNAc:4 NeuAc:1 (avg mass : 1770.6228 )
- Hex:4 HexNAc:4 dHex:1 (avg mass : 1625.5079 )
- Hex:4 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 1916.7658 )
- Hex:4 HexNAc:5 (avg mass : 1682.5599 )
- Hex:4 HexNAc:5 dHex:1 (avg mass : 1828.7029 )
- Hex:5 HexNAc:4 (avg mass : 1641.5073 )
- Hex:5 HexNAc:4 NeuAc:1 (avg mass : 1932.7652 )
- Hex:5 HexNAc:4 dHex:1 (avg mass : 1787.6503 )
- Hex:5 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 2078.9082 )
- Hex:5 HexNAc:5 (avg mass : 1844.7023 )
- Hex:5 HexNAc:5 dHex:1 (avg mass : 1990.8453 )
Composition
- Asymptomatic myositis (DOID:633)
- Cancer, breast (DOID:1612)
- Control/Healthy
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- Myositis (DOID:633)
Disease
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- Mass Spectrometric Determination of IgG Subclass-Specific Glycosylation Profiles in Siblings Discordant for Myositis Syndromes (2011 - Irina Perdivara, Shyamal D. Peddada, Frederick W. Miller, Kenneth B. Tomer, Leesa J. Deterding) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
Reference
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
Reported glycosite
- SCDTPPPCPR (10aa)
- EEQYNSTFR (9aa)
- EEQFNSTFR (9aa)
- GFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSK (39aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 1260.1705)
- Blood Serum (UBERON_0001977)
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1276.1699)
- Blood Serum (UBERON_0001977)
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1317.2225)
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- Mass Spectrometric Determination of IgG Subclass-Specific Glycosylation Profiles in Siblings Discordant for Myositis Syndromes (2011 - Irina Perdivara, Shyamal D. Peddada, Frederick W. Miller, Kenneth B. Tomer, Leesa J. Deterding) / Status : Reviewed
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- EEQFNSTFR (9aa)
-
- N-Linked / Complex
(avg mass : 1317.2225)
- Blood Serum (UBERON_0001977)
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1422.3129)
- Blood Serum (UBERON_0001977)
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1463.3655)
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- Mass Spectrometric Determination of IgG Subclass-Specific Glycosylation Profiles in Siblings Discordant for Myositis Syndromes (2011 - Irina Perdivara, Shyamal D. Peddada, Frederick W. Miller, Kenneth B. Tomer, Leesa J. Deterding) / Status : Reviewed
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- EEQFNSTFR (9aa)
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1463.3655)
- Blood Serum (UBERON_0001977)
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Blood Serum (UBERON_0001977)
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Blood Serum (UBERON_0001977)
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- Mass Spectrometric Determination of IgG Subclass-Specific Glycosylation Profiles in Siblings Discordant for Myositis Syndromes (2011 - Irina Perdivara, Shyamal D. Peddada, Frederick W. Miller, Kenneth B. Tomer, Leesa J. Deterding) / Status : Reviewed
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- EEQFNSTFR (9aa)
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1520.4175)
- Blood Serum (UBERON_0001977)
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1520.4175)
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1625.5079)
- Blood Serum (UBERON_0001977)
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1625.5079)
- Blood Serum (UBERON_0001977)
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1625.5079)
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- Mass Spectrometric Determination of IgG Subclass-Specific Glycosylation Profiles in Siblings Discordant for Myositis Syndromes (2011 - Irina Perdivara, Shyamal D. Peddada, Frederick W. Miller, Kenneth B. Tomer, Leesa J. Deterding) / Status : Reviewed
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- EEQFNSTFR (9aa)
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1641.5073)
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- Mass Spectrometric Determination of IgG Subclass-Specific Glycosylation Profiles in Siblings Discordant for Myositis Syndromes (2011 - Irina Perdivara, Shyamal D. Peddada, Frederick W. Miller, Kenneth B. Tomer, Leesa J. Deterding) / Status : Reviewed
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- EEQFNSTFR (9aa)
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1641.5073)
- Blood Serum (UBERON_0001977)
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- Mass Spectrometric Determination of IgG Subclass-Specific Glycosylation Profiles in Siblings Discordant for Myositis Syndromes (2011 - Irina Perdivara, Shyamal D. Peddada, Frederick W. Miller, Kenneth B. Tomer, Leesa J. Deterding) / Status : Reviewed
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- EEQFNSTFR (9aa)
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Blood Serum (UBERON_0001977)
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1682.5599)
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1770.6228)
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1787.6503)
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- Mass Spectrometric Determination of IgG Subclass-Specific Glycosylation Profiles in Siblings Discordant for Myositis Syndromes (2011 - Irina Perdivara, Shyamal D. Peddada, Frederick W. Miller, Kenneth B. Tomer, Leesa J. Deterding) / Status : Reviewed
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- EEQFNSTFR (9aa)
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1787.6503)
- Blood Serum (UBERON_0001977)
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1828.7029)
- Blood Serum (UBERON_0001977)
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1828.7029)
- Blood Serum (UBERON_0001977)
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1828.7029)
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- Mass Spectrometric Determination of IgG Subclass-Specific Glycosylation Profiles in Siblings Discordant for Myositis Syndromes (2011 - Irina Perdivara, Shyamal D. Peddada, Frederick W. Miller, Kenneth B. Tomer, Leesa J. Deterding) / Status : Reviewed
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- EEQFNSTFR (9aa)
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1844.7023)
- Blood Serum (UBERON_0001977)
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1844.7023)
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1916.7658)
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- Mass Spectrometric Determination of IgG Subclass-Specific Glycosylation Profiles in Siblings Discordant for Myositis Syndromes (2011 - Irina Perdivara, Shyamal D. Peddada, Frederick W. Miller, Kenneth B. Tomer, Leesa J. Deterding) / Status : Reviewed
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- EEQFNSTFR (9aa)
-
- N-Linked / Complex
(avg mass : 1932.7652)
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1990.8453)
- Blood Serum (UBERON_0001977)
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1990.8453)
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- Mass Spectrometric Determination of IgG Subclass-Specific Glycosylation Profiles in Siblings Discordant for Myositis Syndromes (2011 - Irina Perdivara, Shyamal D. Peddada, Frederick W. Miller, Kenneth B. Tomer, Leesa J. Deterding) / Status : Reviewed
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- EEQFNSTFR (9aa)
-
- N-Linked / Complex
(avg mass : 2078.9082)
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- Mass Spectrometric Determination of IgG Subclass-Specific Glycosylation Profiles in Siblings Discordant for Myositis Syndromes (2011 - Irina Perdivara, Shyamal D. Peddada, Frederick W. Miller, Kenneth B. Tomer, Leesa J. Deterding) / Status : Reviewed
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- EEQFNSTFR (9aa)
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
- O-Linked / Core 1
(avg mass : 383.3527)
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- SCDTPPPCPR (10aa)
-
- O-Linked / Core 1
(avg mass : 674.6106)
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- SCDTPPPCPR (10aa)
-
- O-Linked / Core 1
(avg mass : 965.8685)
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- SCDTPPPCPR (10aa)
-
- Hex:3 HexNAc:4 dHex:1 / N-Linked
(avg mass : 1463.3655)
- N-Linked / Complex / Structure 2643
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- Cancer, breast (DOID:1612)
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- EEQYNSTFR (9aa)
-
- Hex:4 HexNAc:4 / N-Linked
(avg mass : 1479.3649)
- Mammary Gland (UBERON_0001911)
- N-Linked / Complex / Structure 2011
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- Cancer, breast (DOID:1612)
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- EEQYNSTFR (9aa)
-
- Hex:3 HexNAc:5 / N-Linked
(avg mass : 1520.4175)
- Mammary Gland (UBERON_0001911)
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 10152
- Cancer, breast (DOID:1612)
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- GFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSK (39aa)
-
- Hex:4 HexNAc:4 dHex:1 / N-Linked
(avg mass : 1625.5079)
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 2719
- Cancer, breast (DOID:1612)
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- EEQYNSTFR (9aa)
-
- Hex:5 HexNAc:4 / N-Linked
(avg mass : 1641.5073)
- Blood Serum (UBERON_0001977)
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- EEQYNSTFR (9aa)
-
- Hex:3 HexNAc:5 dHex:1 / N-Linked
(avg mass : 1666.5605)
- Mammary Gland (UBERON_0001911)
- N-Linked / Complex / Structure 2888
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- Cancer, breast (DOID:1612)
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- EEQYNSTFR (9aa)
-
- Hex:4 HexNAc:5 / N-Linked
(avg mass : 1682.5599)
- Mammary Gland (UBERON_0001911)
- N-Linked / Complex / Structure 2104
- Cancer, breast (DOID:1612)
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- GFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSK (39aa)
-
- Hex:5 HexNAc:4 dHex:1 / N-Linked
(avg mass : 1787.6503)
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- Cancer, breast (DOID:1612)
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- EEQYNSTFR (9aa)
-
- Hex:4 HexNAc:5 dHex:1 / N-Linked
(avg mass : 1828.7029)
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10049
- Cancer, breast (DOID:1612)
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- EEQYNSTFR (9aa)
-
- Hex:5 HexNAc:5 / N-Linked
(avg mass : 1844.7023)
- Mammary Gland (UBERON_0001911)
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 1147
- Cancer, breast (DOID:1612)
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- GFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSK (39aa)
-
- Hex:5 HexNAc:4 dHex:1 NeuAc:1 / N-Linked
(avg mass : 2078.9082)
- Blood Serum (UBERON_0001977)
- N-Linked / Complex / Structure 1523
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- EEQYNSTFR (9aa)
Source
Suggested structure
Reported glycosite
Mass spectrometry observed peptide
- Hex:5 HexNAc:4 dHex:1 NeuAc:1 / N-Linked
(avg mass : 2078.9082)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:5 HexNAc:5 / N-Linked
(avg mass : 1844.7023)
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:4 HexNAc:5 dHex:1 / N-Linked
(avg mass : 1828.7029)
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:5 HexNAc:4 dHex:1 / N-Linked
(avg mass : 1787.6503)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:4 HexNAc:5 / N-Linked
(avg mass : 1682.5599)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:3 HexNAc:5 dHex:1 / N-Linked
(avg mass : 1666.5605)
Source
Suggested structure
Reported glycosite
Mass spectrometry observed peptide
- Hex:5 HexNAc:4 / N-Linked
(avg mass : 1641.5073)
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:4 HexNAc:4 dHex:1 / N-Linked
(avg mass : 1625.5079)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:3 HexNAc:5 / N-Linked
(avg mass : 1520.4175)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:4 HexNAc:4 / N-Linked
(avg mass : 1479.3649)
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:3 HexNAc:4 dHex:1 / N-Linked
(avg mass : 1463.3655)
Reported glycosite
Mass spectrometry observed peptide
Suggested glycosite
- O-Linked / Core 1
(avg mass : 965.8685)
Reported glycosite
Mass spectrometry observed peptide
Suggested glycosite
- O-Linked / Core 1
(avg mass : 674.6106)
Reported glycosite
Mass spectrometry observed peptide
Suggested glycosite
- O-Linked / Core 1
(avg mass : 383.3527)
Reference
Reported glycosite
Mass spectrometry observed peptide
Suggested glycosite
- N-Linked / Complex
(avg mass : 2078.9082)
Reference
Reported glycosite
Mass spectrometry observed peptide
Suggested glycosite
- N-Linked / Complex
(avg mass : 1990.8453)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1990.8453)
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1932.7652)
Reference
Reported glycosite
Mass spectrometry observed peptide
Suggested glycosite
- N-Linked / Complex
(avg mass : 1916.7658)
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1844.7023)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1844.7023)
Reference
Reported glycosite
Mass spectrometry observed peptide
Suggested glycosite
- N-Linked / Complex
(avg mass : 1828.7029)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1828.7029)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1828.7029)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1787.6503)
Reference
Reported glycosite
Mass spectrometry observed peptide
Suggested glycosite
- N-Linked / Complex
(avg mass : 1787.6503)
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1770.6228)
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1682.5599)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Reference
Reported glycosite
Mass spectrometry observed peptide
Suggested glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1641.5073)
Reference
Reported glycosite
Mass spectrometry observed peptide
Suggested glycosite
- N-Linked / Complex
(avg mass : 1641.5073)
Reference
Reported glycosite
Mass spectrometry observed peptide
Suggested glycosite
- N-Linked / Complex
(avg mass : 1625.5079)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1625.5079)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1625.5079)
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1520.4175)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1520.4175)
Reference
Reported glycosite
Mass spectrometry observed peptide
Suggested glycosite
- N-Linked / Complex
(avg mass : 1479.3649)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1479.3649)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1479.3649)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1463.3655)
Reference
Reported glycosite
Mass spectrometry observed peptide
Suggested glycosite
- N-Linked / Complex
(avg mass : 1463.3655)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1422.3129)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1317.2225)
Reference
Reported glycosite
Mass spectrometry observed peptide
Suggested glycosite
- N-Linked / Complex
(avg mass : 1317.2225)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1276.1699)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1260.1705)