QSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPK
Nothing to display
The following components make up GlyConnect:
Wednesday, October 11, 2023
Improvement :
Wednesday, October 11, 2023
New : Introducing a brand new Glycome Graph view, providing a comprehensive depiction of protein glycosylations derived from a selection of scientific publications. Here is an illustrative example:
Friday, July 7, 2023
Bug Fixes : The /api/glycosylations
end point now returns all glycosylations when empty parameters are provided.
Friday, May 12, 2023
Improvement : The web pages have been enhanced and optimized, leading to improved response times.
Friday, February 24, 2023
New : The GlyConnect DB has been updated, resulting in an increased number of annotated glycosylations within our database.