Show All Peptides

Filtering tool help



Id Sequence Length Biological associations
4979 DFGGFNFSQILPDPSK 16
4983 EGVFVSNGTHWFVTQR 16
4986 YNENGTITDAVDCALDPLSETK 22

    Reported structure

4987 TPPIKDFGGFNFSQILPDPSKPSK 24

    Reported structure

4990 NSVAYSNNSIAIPTNFTISVTTE 23
4992 KNFTTAPAICHDGK 14
4994 TPPIKDFGGFNFSQILPDPSKPSKR 25

    Reported structure

4996 NGTITDAVDCALDPLSETK 19
5001 DFGGFNFSQILPDPSKPSK 19
5002 VYSSANNCTFEYVSQPFLMDLEGK 24
5003 VFNATR 6
5005 AGCLIGAEHVNNSYE 15
5011 NLNESLIDLQELGK 14

    Reported structure

5013 GVFVSNGTHWFVTQR 15
5018 PLVDLPIGINITR 13
5025 VCEFQFCNDPFLGVYYHKNNK 21

    Reported structure

5027 NLNESLIDLQELGKYEQYIK 20

    Reported structure

5034 DLPQGFSALEPLVDLPIGINITR 23

    Reported structure

5035 TQSLLIVNNATNVVIK 16
5037 NHTSPDVDLGDISGINASVVNIQK 24
5038 NFTTAPAICHDGKAHFPR 18

    Reported structure

5040 HVNNSYE 7
5047 VYSSANNCTFE 11
5051 NFTTAPAICHDGK 13
5057 FPNITNLCPFGE 12
5058 NGTITDAVDCALDPLSE 17
5060 DFGGFNFSQILPDPSKPSKR 20

    Reported structure

5318 SLLIVNNATNVVIK 14

    Reported structure

5323 VQPTESIVR 9

    Reported structure

5337 VPAQEKNFTTAPAICHDGKAHFPREGVF 28

    Reported structure

5341 FHAIHVSGTNGTKR 14

    Reported structure

5342 NFNFSQILPDPSKPSKR 17

    Reported structure

5352 NFSQILPDPSKPSK 14

    Reported structure

5390 HAIHVSGTNGTKRF 14
5394 FPNIT 5
5396 SIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGS 68

    Reported structure

5403 HAIHVSGTNGTKRFDNPVLPF 21

    Reported structure

5416 VPAQEKNFTTAPAICHDGK 19

    Reported structure