GlyConnect

Export CSV

Site	Core / Type	Composition	Biological associations
Thr-490	O-Linked / O-GlcNAc	HexNAc:1	taxonomy (1) protein (1) source (1) structure (1) composition (1) disease (0) reference (1) site (30) peptide (1) Taxonomy Homo sapiens (Human) Protein Host Cell Factor 1 / Homo sapiens P51610 Source HeLa (CVCL_0030) Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Extensive Crosstalk Between O-GlcNAcylation and Phosphorylation Regulates Cytokinesis (2010 - Zihao Wang, Namrata D Udeshi, Chad Slawson, Philip D Compton, Kaoru Sakabe, Win D Cheung, Jeffrey Shabanowitz, Donald F Hunt, Gerald W Hart) / Status : Reviewed Reported glycosite Host Cell Factor 1 / Homo sapiens Thr-490 Thr-495 Ser-562 Ser-563 Ser-569 Thr-579 Ser-620 Ser-622 Ser-623 Thr-625 Thr-651 Thr-652 Ser-685 Thr-694 Thr-726 Thr-739 Thr-760 Thr-779 Thr-801 Ser-806 Thr-808 Thr-861 Thr-1030 Thr-1031 Thr-1143 Ser-1150 Thr-1239 Thr-1273 Thr-1335 Thr-1743 Mass spectrometry observed peptide VTGPQATGTPLVTMRPASQAGK (22aa) P51610 Thr-495 Host Cell Factor 1 / Homo sapiens P51610 Thr-490 Host Cell Factor 1 / Homo sapiens
Thr-495	O-Linked / O-GlcNAc	HexNAc:1	taxonomy (1) protein (1) source (1) structure (1) composition (1) disease (0) reference (1) site (30) peptide (1) Taxonomy Homo sapiens (Human) Protein Host Cell Factor 1 / Homo sapiens P51610 Source HEK293 (CVCL_0045) Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Electron Transfer Dissociation (ETD): The Mass Spectrometric Breakthrough Essential for O-GlcNAc Protein Site Assignments-A Study of the O-GlcNAcylated Protein Host Cell Factor C1 (2013 - Samuel A Myers, Salima Daou, El Bachir Affar, Al Burlingame) / Status : Reviewed Reported glycosite Host Cell Factor 1 / Homo sapiens Thr-490 Thr-495 Ser-562 Ser-563 Ser-569 Thr-579 Ser-620 Ser-622 Ser-623 Thr-625 Thr-651 Thr-652 Ser-685 Thr-694 Thr-726 Thr-739 Thr-760 Thr-779 Thr-801 Ser-806 Thr-808 Thr-861 Thr-1030 Thr-1031 Thr-1143 Ser-1150 Thr-1239 Thr-1273 Thr-1335 Thr-1743 Mass spectrometry observed peptide VTGPQATGTPLVTMRPASQAGK (22aa) P51610 Thr-495 Host Cell Factor 1 / Homo sapiens P51610 Thr-490 Host Cell Factor 1 / Homo sapiens
Ser-562	O-Linked / O-GlcNAc	HexNAc:1	taxonomy (1) protein (1) source (1) structure (1) composition (1) disease (0) reference (1) site (30) peptide (1) Taxonomy Homo sapiens (Human) Protein Host Cell Factor 1 / Homo sapiens P51610 Source HeLa (CVCL_0030) Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Extensive Crosstalk Between O-GlcNAcylation and Phosphorylation Regulates Cytokinesis (2010 - Zihao Wang, Namrata D Udeshi, Chad Slawson, Philip D Compton, Kaoru Sakabe, Win D Cheung, Jeffrey Shabanowitz, Donald F Hunt, Gerald W Hart) / Status : Reviewed Reported glycosite Host Cell Factor 1 / Homo sapiens Thr-490 Thr-495 Ser-562 Ser-563 Ser-569 Thr-579 Ser-620 Ser-622 Ser-623 Thr-625 Thr-651 Thr-652 Ser-685 Thr-694 Thr-726 Thr-739 Thr-760 Thr-779 Thr-801 Ser-806 Thr-808 Thr-861 Thr-1030 Thr-1031 Thr-1143 Ser-1150 Thr-1239 Thr-1273 Thr-1335 Thr-1743 Mass spectrometry observed peptide IPPSSAPTVLSVPAGTTIVK (20aa) P51610 Ser-563 Host Cell Factor 1 / Homo sapiens P51610 Ser-562 Host Cell Factor 1 / Homo sapiens
Ser-563	O-Linked / O-GlcNAc	HexNAc:1	taxonomy (1) protein (1) source (1) structure (1) composition (1) disease (0) reference (1) site (30) peptide (1) Taxonomy Homo sapiens (Human) Protein Host Cell Factor 1 / Homo sapiens P51610 Source HeLa (CVCL_0030) Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Extensive Crosstalk Between O-GlcNAcylation and Phosphorylation Regulates Cytokinesis (2010 - Zihao Wang, Namrata D Udeshi, Chad Slawson, Philip D Compton, Kaoru Sakabe, Win D Cheung, Jeffrey Shabanowitz, Donald F Hunt, Gerald W Hart) / Status : Reviewed Reported glycosite Host Cell Factor 1 / Homo sapiens Thr-490 Thr-495 Ser-562 Ser-563 Ser-569 Thr-579 Ser-620 Ser-622 Ser-623 Thr-625 Thr-651 Thr-652 Ser-685 Thr-694 Thr-726 Thr-739 Thr-760 Thr-779 Thr-801 Ser-806 Thr-808 Thr-861 Thr-1030 Thr-1031 Thr-1143 Ser-1150 Thr-1239 Thr-1273 Thr-1335 Thr-1743 Mass spectrometry observed peptide IPPSSAPTVLSVPAGTTIVK (20aa) P51610 Ser-563 Host Cell Factor 1 / Homo sapiens P51610 Ser-562 Host Cell Factor 1 / Homo sapiens
Ser-569	O-Linked / O-GlcNAc	HexNAc:1	taxonomy (1) protein (1) source (1) structure (1) composition (1) disease (0) reference (1) site (30) peptide (1) Taxonomy Homo sapiens (Human) Protein Host Cell Factor 1 / Homo sapiens P51610 Source HEK293 (CVCL_0045) Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Electron Transfer Dissociation (ETD): The Mass Spectrometric Breakthrough Essential for O-GlcNAc Protein Site Assignments-A Study of the O-GlcNAcylated Protein Host Cell Factor C1 (2013 - Samuel A Myers, Salima Daou, El Bachir Affar, Al Burlingame) / Status : Reviewed Reported glycosite Host Cell Factor 1 / Homo sapiens Thr-490 Thr-495 Ser-562 Ser-563 Ser-569 Thr-579 Ser-620 Ser-622 Ser-623 Thr-625 Thr-651 Thr-652 Ser-685 Thr-694 Thr-726 Thr-739 Thr-760 Thr-779 Thr-801 Ser-806 Thr-808 Thr-861 Thr-1030 Thr-1031 Thr-1143 Ser-1150 Thr-1239 Thr-1273 Thr-1335 Thr-1743 Mass spectrometry observed peptide IPPSSAPTVLSVPAGTTIVKTMAVTPGTTTLPATVK (36aa) P51610 Ser-569 Host Cell Factor 1 / Homo sapiens
Thr-579	O-Linked / O-GlcNAc	HexNAc:1	taxonomy (1) protein (1) source (1) structure (1) composition (1) disease (0) reference (1) site (30) peptide (1) Taxonomy Homo sapiens (Human) Protein Host Cell Factor 1 / Homo sapiens P51610 Source HeLa (CVCL_0030) Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Extensive Crosstalk Between O-GlcNAcylation and Phosphorylation Regulates Cytokinesis (2010 - Zihao Wang, Namrata D Udeshi, Chad Slawson, Philip D Compton, Kaoru Sakabe, Win D Cheung, Jeffrey Shabanowitz, Donald F Hunt, Gerald W Hart) / Status : Reviewed Reported glycosite Host Cell Factor 1 / Homo sapiens Thr-490 Thr-495 Ser-562 Ser-563 Ser-569 Thr-579 Ser-620 Ser-622 Ser-623 Thr-625 Thr-651 Thr-652 Ser-685 Thr-694 Thr-726 Thr-739 Thr-760 Thr-779 Thr-801 Ser-806 Thr-808 Thr-861 Thr-1030 Thr-1031 Thr-1143 Ser-1150 Thr-1239 Thr-1273 Thr-1335 Thr-1743 Mass spectrometry observed peptide TMAVTPGTTTLPATVK (16aa) P51610 Thr-579 Host Cell Factor 1 / Homo sapiens
Ser-620	O-Linked / O-GlcNAc	HexNAc:1	taxonomy (1) protein (1) source (1) structure (1) composition (1) disease (0) reference (1) site (30) peptide (1) Taxonomy Homo sapiens (Human) Protein Host Cell Factor 1 / Homo sapiens P51610 Source HEK293 (CVCL_0045) Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Electron Transfer Dissociation (ETD): The Mass Spectrometric Breakthrough Essential for O-GlcNAc Protein Site Assignments-A Study of the O-GlcNAcylated Protein Host Cell Factor C1 (2013 - Samuel A Myers, Salima Daou, El Bachir Affar, Al Burlingame) / Status : Reviewed Reported glycosite Host Cell Factor 1 / Homo sapiens Thr-490 Thr-495 Ser-562 Ser-563 Ser-569 Thr-579 Ser-620 Ser-622 Ser-623 Thr-625 Thr-651 Thr-652 Ser-685 Thr-694 Thr-726 Thr-739 Thr-760 Thr-779 Thr-801 Ser-806 Thr-808 Thr-861 Thr-1030 Thr-1031 Thr-1143 Ser-1150 Thr-1239 Thr-1273 Thr-1335 Thr-1743 Mass spectrometry observed peptide TAAAQVGTSVSSATNTSTRPIITVHK (26aa) P51610 Thr-625 Host Cell Factor 1 / Homo sapiens P51610 Ser-622 Host Cell Factor 1 / Homo sapiens P51610 Ser-620 Host Cell Factor 1 / Homo sapiens P51610 Ser-623 Host Cell Factor 1 / Homo sapiens
Ser-622	O-Linked / O-GlcNAc	HexNAc:1	taxonomy (1) protein (1) source (1) structure (1) composition (1) disease (0) reference (1) site (30) peptide (1) Taxonomy Homo sapiens (Human) Protein Host Cell Factor 1 / Homo sapiens P51610 Source HEK293 (CVCL_0045) Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Electron Transfer Dissociation (ETD): The Mass Spectrometric Breakthrough Essential for O-GlcNAc Protein Site Assignments-A Study of the O-GlcNAcylated Protein Host Cell Factor C1 (2013 - Samuel A Myers, Salima Daou, El Bachir Affar, Al Burlingame) / Status : Reviewed Reported glycosite Host Cell Factor 1 / Homo sapiens Thr-490 Thr-495 Ser-562 Ser-563 Ser-569 Thr-579 Ser-620 Ser-622 Ser-623 Thr-625 Thr-651 Thr-652 Ser-685 Thr-694 Thr-726 Thr-739 Thr-760 Thr-779 Thr-801 Ser-806 Thr-808 Thr-861 Thr-1030 Thr-1031 Thr-1143 Ser-1150 Thr-1239 Thr-1273 Thr-1335 Thr-1743 Mass spectrometry observed peptide TAAAQVGTSVSSATNTSTRPIITVHK (26aa) P51610 Thr-625 Host Cell Factor 1 / Homo sapiens P51610 Ser-622 Host Cell Factor 1 / Homo sapiens P51610 Ser-620 Host Cell Factor 1 / Homo sapiens P51610 Ser-623 Host Cell Factor 1 / Homo sapiens
Ser-623	O-Linked / O-GlcNAc	HexNAc:1	taxonomy (1) protein (1) source (1) structure (1) composition (1) disease (0) reference (1) site (30) peptide (1) Taxonomy Homo sapiens (Human) Protein Host Cell Factor 1 / Homo sapiens P51610 Source HEK293 (CVCL_0045) Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Electron Transfer Dissociation (ETD): The Mass Spectrometric Breakthrough Essential for O-GlcNAc Protein Site Assignments-A Study of the O-GlcNAcylated Protein Host Cell Factor C1 (2013 - Samuel A Myers, Salima Daou, El Bachir Affar, Al Burlingame) / Status : Reviewed Reported glycosite Host Cell Factor 1 / Homo sapiens Thr-490 Thr-495 Ser-562 Ser-563 Ser-569 Thr-579 Ser-620 Ser-622 Ser-623 Thr-625 Thr-651 Thr-652 Ser-685 Thr-694 Thr-726 Thr-739 Thr-760 Thr-779 Thr-801 Ser-806 Thr-808 Thr-861 Thr-1030 Thr-1031 Thr-1143 Ser-1150 Thr-1239 Thr-1273 Thr-1335 Thr-1743 Mass spectrometry observed peptide TAAAQVGTSVSSATNTSTRPIITVHK (26aa) P51610 Thr-625 Host Cell Factor 1 / Homo sapiens P51610 Ser-622 Host Cell Factor 1 / Homo sapiens P51610 Ser-620 Host Cell Factor 1 / Homo sapiens P51610 Ser-623 Host Cell Factor 1 / Homo sapiens
Thr-625	O-Linked / O-GlcNAc	HexNAc:1	taxonomy (1) protein (1) source (1) structure (1) composition (1) disease (0) reference (1) site (30) peptide (1) Taxonomy Homo sapiens (Human) Protein Host Cell Factor 1 / Homo sapiens P51610 Source HEK293 (CVCL_0045) Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Electron Transfer Dissociation (ETD): The Mass Spectrometric Breakthrough Essential for O-GlcNAc Protein Site Assignments-A Study of the O-GlcNAcylated Protein Host Cell Factor C1 (2013 - Samuel A Myers, Salima Daou, El Bachir Affar, Al Burlingame) / Status : Reviewed Reported glycosite Host Cell Factor 1 / Homo sapiens Thr-490 Thr-495 Ser-562 Ser-563 Ser-569 Thr-579 Ser-620 Ser-622 Ser-623 Thr-625 Thr-651 Thr-652 Ser-685 Thr-694 Thr-726 Thr-739 Thr-760 Thr-779 Thr-801 Ser-806 Thr-808 Thr-861 Thr-1030 Thr-1031 Thr-1143 Ser-1150 Thr-1239 Thr-1273 Thr-1335 Thr-1743 Mass spectrometry observed peptide TAAAQVGTSVSSATNTSTRPIITVHK (26aa) P51610 Thr-625 Host Cell Factor 1 / Homo sapiens P51610 Ser-622 Host Cell Factor 1 / Homo sapiens P51610 Ser-620 Host Cell Factor 1 / Homo sapiens P51610 Ser-623 Host Cell Factor 1 / Homo sapiens
Thr-651	O-Linked / O-GlcNAc	HexNAc:1	taxonomy (1) protein (1) source (1) structure (1) composition (1) disease (0) reference (1) site (30) peptide (1) Taxonomy Homo sapiens (Human) Protein Host Cell Factor 1 / Homo sapiens P51610 Source HEK293 (CVCL_0045) Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Electron Transfer Dissociation (ETD): The Mass Spectrometric Breakthrough Essential for O-GlcNAc Protein Site Assignments-A Study of the O-GlcNAcylated Protein Host Cell Factor C1 (2013 - Samuel A Myers, Salima Daou, El Bachir Affar, Al Burlingame) / Status : Reviewed Reported glycosite Host Cell Factor 1 / Homo sapiens Thr-490 Thr-495 Ser-562 Ser-563 Ser-569 Thr-579 Ser-620 Ser-622 Ser-623 Thr-625 Thr-651 Thr-652 Ser-685 Thr-694 Thr-726 Thr-739 Thr-760 Thr-779 Thr-801 Ser-806 Thr-808 Thr-861 Thr-1030 Thr-1031 Thr-1143 Ser-1150 Thr-1239 Thr-1273 Thr-1335 Thr-1743 Mass spectrometry observed peptide SGTVTVAQQAQVVTTVVGGVTK (22aa) P51610 Thr-652 Host Cell Factor 1 / Homo sapiens P51610 Thr-651 Host Cell Factor 1 / Homo sapiens
Thr-652	O-Linked / O-GlcNAc	HexNAc:1	taxonomy (1) protein (1) source (1) structure (1) composition (1) disease (0) reference (1) site (30) peptide (1) Taxonomy Homo sapiens (Human) Protein Host Cell Factor 1 / Homo sapiens P51610 Source HEK293 (CVCL_0045) Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Electron Transfer Dissociation (ETD): The Mass Spectrometric Breakthrough Essential for O-GlcNAc Protein Site Assignments-A Study of the O-GlcNAcylated Protein Host Cell Factor C1 (2013 - Samuel A Myers, Salima Daou, El Bachir Affar, Al Burlingame) / Status : Reviewed Reported glycosite Host Cell Factor 1 / Homo sapiens Thr-490 Thr-495 Ser-562 Ser-563 Ser-569 Thr-579 Ser-620 Ser-622 Ser-623 Thr-625 Thr-651 Thr-652 Ser-685 Thr-694 Thr-726 Thr-739 Thr-760 Thr-779 Thr-801 Ser-806 Thr-808 Thr-861 Thr-1030 Thr-1031 Thr-1143 Ser-1150 Thr-1239 Thr-1273 Thr-1335 Thr-1743 Mass spectrometry observed peptide SGTVTVAQQAQVVTTVVGGVTK (22aa) P51610 Thr-652 Host Cell Factor 1 / Homo sapiens P51610 Thr-651 Host Cell Factor 1 / Homo sapiens
Ser-685	O-Linked / O-GlcNAc	HexNAc:1	taxonomy (1) protein (1) source (2) structure (1) composition (1) disease (0) reference (2) site (30) peptide (1) Taxonomy Homo sapiens (Human) Protein Host Cell Factor 1 / Homo sapiens P51610 Source HEK293 (CVCL_0045) HeLa (CVCL_0030) Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Electron Transfer Dissociation (ETD): The Mass Spectrometric Breakthrough Essential for O-GlcNAc Protein Site Assignments-A Study of the O-GlcNAcylated Protein Host Cell Factor C1 (2013 - Samuel A Myers, Salima Daou, El Bachir Affar, Al Burlingame) / Status : Reviewed Extensive Crosstalk Between O-GlcNAcylation and Phosphorylation Regulates Cytokinesis (2010 - Zihao Wang, Namrata D Udeshi, Chad Slawson, Philip D Compton, Kaoru Sakabe, Win D Cheung, Jeffrey Shabanowitz, Donald F Hunt, Gerald W Hart) / Status : Reviewed Reported glycosite Host Cell Factor 1 / Homo sapiens Thr-490 Thr-495 Ser-562 Ser-563 Ser-569 Thr-579 Ser-620 Ser-622 Ser-623 Thr-625 Thr-651 Thr-652 Ser-685 Thr-694 Thr-726 Thr-739 Thr-760 Thr-779 Thr-801 Ser-806 Thr-808 Thr-861 Thr-1030 Thr-1031 Thr-1143 Ser-1150 Thr-1239 Thr-1273 Thr-1335 Thr-1743 Mass spectrometry observed peptide VMSVVQTKPVQTSAVTGQASTGPVTQIIQTK (31aa) P51610 Ser-685 Host Cell Factor 1 / Homo sapiens
Thr-694	O-Linked / O-GlcNAc	HexNAc:1	taxonomy (1) protein (1) source (1) structure (1) composition (1) disease (0) reference (1) site (30) peptide (1) Taxonomy Homo sapiens (Human) Protein Host Cell Factor 1 / Homo sapiens P51610 Source HeLa (CVCL_0030) Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Extensive Crosstalk Between O-GlcNAcylation and Phosphorylation Regulates Cytokinesis (2010 - Zihao Wang, Namrata D Udeshi, Chad Slawson, Philip D Compton, Kaoru Sakabe, Win D Cheung, Jeffrey Shabanowitz, Donald F Hunt, Gerald W Hart) / Status : Reviewed Reported glycosite Host Cell Factor 1 / Homo sapiens Thr-490 Thr-495 Ser-562 Ser-563 Ser-569 Thr-579 Ser-620 Ser-622 Ser-623 Thr-625 Thr-651 Thr-652 Ser-685 Thr-694 Thr-726 Thr-739 Thr-760 Thr-779 Thr-801 Ser-806 Thr-808 Thr-861 Thr-1030 Thr-1031 Thr-1143 Ser-1150 Thr-1239 Thr-1273 Thr-1335 Thr-1743 Mass spectrometry observed peptide PVQTSAVTGQASTGPVTQIIQTK (23aa) P51610 Thr-694 Host Cell Factor 1 / Homo sapiens
Thr-726	O-Linked / O-GlcNAc	HexNAc:1	taxonomy (1) protein (1) source (2) structure (1) composition (1) disease (0) reference (2) site (30) peptide (1) Taxonomy Homo sapiens (Human) Protein Host Cell Factor 1 / Homo sapiens P51610 Source HEK293 (CVCL_0045) HeLa (CVCL_0030) Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Electron Transfer Dissociation (ETD): The Mass Spectrometric Breakthrough Essential for O-GlcNAc Protein Site Assignments-A Study of the O-GlcNAcylated Protein Host Cell Factor C1 (2013 - Samuel A Myers, Salima Daou, El Bachir Affar, Al Burlingame) / Status : Reviewed Extensive Crosstalk Between O-GlcNAcylation and Phosphorylation Regulates Cytokinesis (2010 - Zihao Wang, Namrata D Udeshi, Chad Slawson, Philip D Compton, Kaoru Sakabe, Win D Cheung, Jeffrey Shabanowitz, Donald F Hunt, Gerald W Hart) / Status : Reviewed Reported glycosite Host Cell Factor 1 / Homo sapiens Thr-490 Thr-495 Ser-562 Ser-563 Ser-569 Thr-579 Ser-620 Ser-622 Ser-623 Thr-625 Thr-651 Thr-652 Ser-685 Thr-694 Thr-726 Thr-739 Thr-760 Thr-779 Thr-801 Ser-806 Thr-808 Thr-861 Thr-1030 Thr-1031 Thr-1143 Ser-1150 Thr-1239 Thr-1273 Thr-1335 Thr-1743 Mass spectrometry observed peptide LVTSADGK (8aa) P51610 Thr-726 Host Cell Factor 1 / Homo sapiens
Thr-739	O-Linked / O-GlcNAc	HexNAc:1	taxonomy (1) protein (1) source (1) structure (1) composition (1) disease (0) reference (1) site (30) peptide (1) Taxonomy Homo sapiens (Human) Protein Host Cell Factor 1 / Homo sapiens P51610 Source HeLa (CVCL_0030) Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Extensive Crosstalk Between O-GlcNAcylation and Phosphorylation Regulates Cytokinesis (2010 - Zihao Wang, Namrata D Udeshi, Chad Slawson, Philip D Compton, Kaoru Sakabe, Win D Cheung, Jeffrey Shabanowitz, Donald F Hunt, Gerald W Hart) / Status : Reviewed Reported glycosite Host Cell Factor 1 / Homo sapiens Thr-490 Thr-495 Ser-562 Ser-563 Ser-569 Thr-579 Ser-620 Ser-622 Ser-623 Thr-625 Thr-651 Thr-652 Ser-685 Thr-694 Thr-726 Thr-739 Thr-760 Thr-779 Thr-801 Ser-806 Thr-808 Thr-861 Thr-1030 Thr-1031 Thr-1143 Ser-1150 Thr-1239 Thr-1273 Thr-1335 Thr-1743 Mass spectrometry observed peptide PTTIITTTQASGAGTK (16aa) P51610 Thr-739 Host Cell Factor 1 / Homo sapiens
Thr-760	O-Linked / O-GlcNAc	HexNAc:1	taxonomy (1) protein (1) source (1) structure (1) composition (1) disease (0) reference (1) site (30) peptide (1) Taxonomy Homo sapiens (Human) Protein Host Cell Factor 1 / Homo sapiens P51610 Source HeLa (CVCL_0030) Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Extensive Crosstalk Between O-GlcNAcylation and Phosphorylation Regulates Cytokinesis (2010 - Zihao Wang, Namrata D Udeshi, Chad Slawson, Philip D Compton, Kaoru Sakabe, Win D Cheung, Jeffrey Shabanowitz, Donald F Hunt, Gerald W Hart) / Status : Reviewed Reported glycosite Host Cell Factor 1 / Homo sapiens Thr-490 Thr-495 Ser-562 Ser-563 Ser-569 Thr-579 Ser-620 Ser-622 Ser-623 Thr-625 Thr-651 Thr-652 Ser-685 Thr-694 Thr-726 Thr-739 Thr-760 Thr-779 Thr-801 Ser-806 Thr-808 Thr-861 Thr-1030 Thr-1031 Thr-1143 Ser-1150 Thr-1239 Thr-1273 Thr-1335 Thr-1743 Mass spectrometry observed peptide PTILGISSVSPSTTKPGTTTIIK (23aa) P51610 Thr-760 Host Cell Factor 1 / Homo sapiens
Thr-779	O-Linked / O-GlcNAc	HexNAc:1	taxonomy (1) protein (1) source (1) structure (1) composition (1) disease (0) reference (1) site (30) peptide (1) Taxonomy Homo sapiens (Human) Protein Host Cell Factor 1 / Homo sapiens P51610 Source HEK293 (CVCL_0045) Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Electron Transfer Dissociation (ETD): The Mass Spectrometric Breakthrough Essential for O-GlcNAc Protein Site Assignments-A Study of the O-GlcNAcylated Protein Host Cell Factor C1 (2013 - Samuel A Myers, Salima Daou, El Bachir Affar, Al Burlingame) / Status : Reviewed Reported glycosite Host Cell Factor 1 / Homo sapiens Thr-490 Thr-495 Ser-562 Ser-563 Ser-569 Thr-579 Ser-620 Ser-622 Ser-623 Thr-625 Thr-651 Thr-652 Ser-685 Thr-694 Thr-726 Thr-739 Thr-760 Thr-779 Thr-801 Ser-806 Thr-808 Thr-861 Thr-1030 Thr-1031 Thr-1143 Ser-1150 Thr-1239 Thr-1273 Thr-1335 Thr-1743 Mass spectrometry observed peptide TIPMSAIITQAGATGVTSSPGIK (23aa) P51610 Thr-779 Host Cell Factor 1 / Homo sapiens
Thr-801	O-Linked / O-GlcNAc	HexNAc:1	taxonomy (1) protein (1) source (1) structure (1) composition (1) disease (0) reference (1) site (30) peptide (1) Taxonomy Homo sapiens (Human) Protein Host Cell Factor 1 / Homo sapiens P51610 Source HeLa (CVCL_0030) Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Extensive Crosstalk Between O-GlcNAcylation and Phosphorylation Regulates Cytokinesis (2010 - Zihao Wang, Namrata D Udeshi, Chad Slawson, Philip D Compton, Kaoru Sakabe, Win D Cheung, Jeffrey Shabanowitz, Donald F Hunt, Gerald W Hart) / Status : Reviewed Reported glycosite Host Cell Factor 1 / Homo sapiens Thr-490 Thr-495 Ser-562 Ser-563 Ser-569 Thr-579 Ser-620 Ser-622 Ser-623 Thr-625 Thr-651 Thr-652 Ser-685 Thr-694 Thr-726 Thr-739 Thr-760 Thr-779 Thr-801 Ser-806 Thr-808 Thr-861 Thr-1030 Thr-1031 Thr-1143 Ser-1150 Thr-1239 Thr-1273 Thr-1335 Thr-1743 Mass spectrometry observed peptide SPITIITTKVMTSGTGAPAK (20aa) P51610 Thr-801 Host Cell Factor 1 / Homo sapiens
Ser-806	O-Linked / O-GlcNAc	HexNAc:1	taxonomy (1) protein (1) source (1) structure (1) composition (1) disease (0) reference (1) site (30) peptide (1) Taxonomy Homo sapiens (Human) Protein Host Cell Factor 1 / Homo sapiens P51610 Source HeLa (CVCL_0030) Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Extensive Crosstalk Between O-GlcNAcylation and Phosphorylation Regulates Cytokinesis (2010 - Zihao Wang, Namrata D Udeshi, Chad Slawson, Philip D Compton, Kaoru Sakabe, Win D Cheung, Jeffrey Shabanowitz, Donald F Hunt, Gerald W Hart) / Status : Reviewed Reported glycosite Host Cell Factor 1 / Homo sapiens Thr-490 Thr-495 Ser-562 Ser-563 Ser-569 Thr-579 Ser-620 Ser-622 Ser-623 Thr-625 Thr-651 Thr-652 Ser-685 Thr-694 Thr-726 Thr-739 Thr-760 Thr-779 Thr-801 Ser-806 Thr-808 Thr-861 Thr-1030 Thr-1031 Thr-1143 Ser-1150 Thr-1239 Thr-1273 Thr-1335 Thr-1743 Mass spectrometry observed peptide VMTSGTGAPAK (11aa) P51610 Ser-806 Host Cell Factor 1 / Homo sapiens P51610 Thr-808 Host Cell Factor 1 / Homo sapiens
Thr-808	O-Linked / O-GlcNAc	HexNAc:1	taxonomy (1) protein (1) source (1) structure (1) composition (1) disease (0) reference (1) site (30) peptide (1) Taxonomy Homo sapiens (Human) Protein Host Cell Factor 1 / Homo sapiens P51610 Source HeLa (CVCL_0030) Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Extensive Crosstalk Between O-GlcNAcylation and Phosphorylation Regulates Cytokinesis (2010 - Zihao Wang, Namrata D Udeshi, Chad Slawson, Philip D Compton, Kaoru Sakabe, Win D Cheung, Jeffrey Shabanowitz, Donald F Hunt, Gerald W Hart) / Status : Reviewed Reported glycosite Host Cell Factor 1 / Homo sapiens Thr-490 Thr-495 Ser-562 Ser-563 Ser-569 Thr-579 Ser-620 Ser-622 Ser-623 Thr-625 Thr-651 Thr-652 Ser-685 Thr-694 Thr-726 Thr-739 Thr-760 Thr-779 Thr-801 Ser-806 Thr-808 Thr-861 Thr-1030 Thr-1031 Thr-1143 Ser-1150 Thr-1239 Thr-1273 Thr-1335 Thr-1743 Mass spectrometry observed peptide VMTSGTGAPAK (11aa) P51610 Ser-806 Host Cell Factor 1 / Homo sapiens P51610 Thr-808 Host Cell Factor 1 / Homo sapiens
Thr-861	O-Linked / O-GlcNAc	HexNAc:1	taxonomy (1) protein (1) source (2) structure (1) composition (1) disease (0) reference (2) site (30) peptide (1) Taxonomy Homo sapiens (Human) Protein Host Cell Factor 1 / Homo sapiens P51610 Source HEK293 (CVCL_0045) HeLa (CVCL_0030) Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Electron Transfer Dissociation (ETD): The Mass Spectrometric Breakthrough Essential for O-GlcNAc Protein Site Assignments-A Study of the O-GlcNAcylated Protein Host Cell Factor C1 (2013 - Samuel A Myers, Salima Daou, El Bachir Affar, Al Burlingame) / Status : Reviewed Extensive Crosstalk Between O-GlcNAcylation and Phosphorylation Regulates Cytokinesis (2010 - Zihao Wang, Namrata D Udeshi, Chad Slawson, Philip D Compton, Kaoru Sakabe, Win D Cheung, Jeffrey Shabanowitz, Donald F Hunt, Gerald W Hart) / Status : Reviewed Reported glycosite Host Cell Factor 1 / Homo sapiens Thr-490 Thr-495 Ser-562 Ser-563 Ser-569 Thr-579 Ser-620 Ser-622 Ser-623 Thr-625 Thr-651 Thr-652 Ser-685 Thr-694 Thr-726 Thr-739 Thr-760 Thr-779 Thr-801 Ser-806 Thr-808 Thr-861 Thr-1030 Thr-1031 Thr-1143 Ser-1150 Thr-1239 Thr-1273 Thr-1335 Thr-1743 Mass spectrometry observed peptide LVTPVTVSAVKPAVTTLVVK (20aa) P51610 Thr-861 Host Cell Factor 1 / Homo sapiens
Thr-1030	O-Linked / O-GlcNAc	HexNAc:1	taxonomy (1) protein (1) source (1) structure (1) composition (1) disease (0) reference (1) site (30) peptide (1) Taxonomy Homo sapiens (Human) Protein Host Cell Factor 1 / Homo sapiens P51610 Source HEK293 (CVCL_0045) Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Electron Transfer Dissociation (ETD): The Mass Spectrometric Breakthrough Essential for O-GlcNAc Protein Site Assignments-A Study of the O-GlcNAcylated Protein Host Cell Factor C1 (2013 - Samuel A Myers, Salima Daou, El Bachir Affar, Al Burlingame) / Status : Reviewed Reported glycosite Host Cell Factor 1 / Homo sapiens Thr-490 Thr-495 Ser-562 Ser-563 Ser-569 Thr-579 Ser-620 Ser-622 Ser-623 Thr-625 Thr-651 Thr-652 Ser-685 Thr-694 Thr-726 Thr-739 Thr-760 Thr-779 Thr-801 Ser-806 Thr-808 Thr-861 Thr-1030 Thr-1031 Thr-1143 Ser-1150 Thr-1239 Thr-1273 Thr-1335 Thr-1743 Mass spectrometry observed peptide TGTTNTATTTVVANLGGHPQPTQVQFVCDRQE (32aa) P51610 Thr-1030 Host Cell Factor 1 / Homo sapiens P51610 Thr-1031 Host Cell Factor 1 / Homo sapiens
Thr-1031	O-Linked / O-GlcNAc	HexNAc:1	taxonomy (1) protein (1) source (1) structure (1) composition (1) disease (0) reference (1) site (30) peptide (1) Taxonomy Homo sapiens (Human) Protein Host Cell Factor 1 / Homo sapiens P51610 Source HEK293 (CVCL_0045) Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Electron Transfer Dissociation (ETD): The Mass Spectrometric Breakthrough Essential for O-GlcNAc Protein Site Assignments-A Study of the O-GlcNAcylated Protein Host Cell Factor C1 (2013 - Samuel A Myers, Salima Daou, El Bachir Affar, Al Burlingame) / Status : Reviewed Reported glycosite Host Cell Factor 1 / Homo sapiens Thr-490 Thr-495 Ser-562 Ser-563 Ser-569 Thr-579 Ser-620 Ser-622 Ser-623 Thr-625 Thr-651 Thr-652 Ser-685 Thr-694 Thr-726 Thr-739 Thr-760 Thr-779 Thr-801 Ser-806 Thr-808 Thr-861 Thr-1030 Thr-1031 Thr-1143 Ser-1150 Thr-1239 Thr-1273 Thr-1335 Thr-1743 Mass spectrometry observed peptide TGTTNTATTTVVANLGGHPQPTQVQFVCDRQE (32aa) P51610 Thr-1030 Host Cell Factor 1 / Homo sapiens P51610 Thr-1031 Host Cell Factor 1 / Homo sapiens
Thr-1143	O-Linked / O-GlcNAc	HexNAc:1	taxonomy (1) protein (1) source (1) structure (1) composition (1) disease (0) reference (1) site (30) peptide (1) Taxonomy Homo sapiens (Human) Protein Host Cell Factor 1 / Homo sapiens P51610 Source HEK293 (CVCL_0045) Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Electron Transfer Dissociation (ETD): The Mass Spectrometric Breakthrough Essential for O-GlcNAc Protein Site Assignments-A Study of the O-GlcNAcylated Protein Host Cell Factor C1 (2013 - Samuel A Myers, Salima Daou, El Bachir Affar, Al Burlingame) / Status : Reviewed Reported glycosite Host Cell Factor 1 / Homo sapiens Thr-490 Thr-495 Ser-562 Ser-563 Ser-569 Thr-579 Ser-620 Ser-622 Ser-623 Thr-625 Thr-651 Thr-652 Ser-685 Thr-694 Thr-726 Thr-739 Thr-760 Thr-779 Thr-801 Ser-806 Thr-808 Thr-861 Thr-1030 Thr-1031 Thr-1143 Ser-1150 Thr-1239 Thr-1273 Thr-1335 Thr-1743 Mass spectrometry observed peptide RACAAGTPAVIR (12aa) P51610 Thr-1143 Host Cell Factor 1 / Homo sapiens
Ser-1150	O-Linked / O-GlcNAc	HexNAc:1	taxonomy (1) protein (1) source (1) structure (1) composition (1) disease (0) reference (1) site (30) peptide (1) Taxonomy Homo sapiens (Human) Protein Host Cell Factor 1 / Homo sapiens P51610 Source HeLa (CVCL_0030) Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Extensive Crosstalk Between O-GlcNAcylation and Phosphorylation Regulates Cytokinesis (2010 - Zihao Wang, Namrata D Udeshi, Chad Slawson, Philip D Compton, Kaoru Sakabe, Win D Cheung, Jeffrey Shabanowitz, Donald F Hunt, Gerald W Hart) / Status : Reviewed Reported glycosite Host Cell Factor 1 / Homo sapiens Thr-490 Thr-495 Ser-562 Ser-563 Ser-569 Thr-579 Ser-620 Ser-622 Ser-623 Thr-625 Thr-651 Thr-652 Ser-685 Thr-694 Thr-726 Thr-739 Thr-760 Thr-779 Thr-801 Ser-806 Thr-808 Thr-861 Thr-1030 Thr-1031 Thr-1143 Ser-1150 Thr-1239 Thr-1273 Thr-1335 Thr-1743 Mass spectrometry observed peptide ISVATGALEAAQGSK (15aa) P51610 Ser-1150 Host Cell Factor 1 / Homo sapiens
Thr-1239	O-Linked / O-GlcNAc	HexNAc:1	taxonomy (1) protein (1) source (1) structure (1) composition (1) disease (0) reference (1) site (30) peptide (1) Taxonomy Homo sapiens (Human) Protein Host Cell Factor 1 / Homo sapiens P51610 Source HeLa (CVCL_0030) Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Extensive Crosstalk Between O-GlcNAcylation and Phosphorylation Regulates Cytokinesis (2010 - Zihao Wang, Namrata D Udeshi, Chad Slawson, Philip D Compton, Kaoru Sakabe, Win D Cheung, Jeffrey Shabanowitz, Donald F Hunt, Gerald W Hart) / Status : Reviewed Reported glycosite Host Cell Factor 1 / Homo sapiens Thr-490 Thr-495 Ser-562 Ser-563 Ser-569 Thr-579 Ser-620 Ser-622 Ser-623 Thr-625 Thr-651 Thr-652 Ser-685 Thr-694 Thr-726 Thr-739 Thr-760 Thr-779 Thr-801 Ser-806 Thr-808 Thr-861 Thr-1030 Thr-1031 Thr-1143 Ser-1150 Thr-1239 Thr-1273 Thr-1335 Thr-1743 Mass spectrometry observed peptide HSHAVSTAAMTR (12aa) P51610 Thr-1239 Host Cell Factor 1 / Homo sapiens
Thr-1273	O-Linked / O-GlcNAc	HexNAc:1	taxonomy (1) protein (1) source (1) structure (1) composition (1) disease (0) reference (1) site (30) peptide (1) Taxonomy Homo sapiens (Human) Protein Host Cell Factor 1 / Homo sapiens P51610 Source HEK293 (CVCL_0045) Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Electron Transfer Dissociation (ETD): The Mass Spectrometric Breakthrough Essential for O-GlcNAc Protein Site Assignments-A Study of the O-GlcNAcylated Protein Host Cell Factor C1 (2013 - Samuel A Myers, Salima Daou, El Bachir Affar, Al Burlingame) / Status : Reviewed Reported glycosite Host Cell Factor 1 / Homo sapiens Thr-490 Thr-495 Ser-562 Ser-563 Ser-569 Thr-579 Ser-620 Ser-622 Ser-623 Thr-625 Thr-651 Thr-652 Ser-685 Thr-694 Thr-726 Thr-739 Thr-760 Thr-779 Thr-801 Ser-806 Thr-808 Thr-861 Thr-1030 Thr-1031 Thr-1143 Ser-1150 Thr-1239 Thr-1273 Thr-1335 Thr-1743 Mass spectrometry observed peptide SLQGGSPSTTVTVTALE (17aa) P51610 Thr-1273 Host Cell Factor 1 / Homo sapiens
Thr-1335	O-Linked / O-GlcNAc	HexNAc:1	taxonomy (1) protein (1) source (1) structure (1) composition (1) disease (0) reference (1) site (30) peptide (1) Taxonomy Homo sapiens (Human) Protein Host Cell Factor 1 / Homo sapiens P51610 Source HEK293 (CVCL_0045) Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Electron Transfer Dissociation (ETD): The Mass Spectrometric Breakthrough Essential for O-GlcNAc Protein Site Assignments-A Study of the O-GlcNAcylated Protein Host Cell Factor C1 (2013 - Samuel A Myers, Salima Daou, El Bachir Affar, Al Burlingame) / Status : Reviewed Reported glycosite Host Cell Factor 1 / Homo sapiens Thr-490 Thr-495 Ser-562 Ser-563 Ser-569 Thr-579 Ser-620 Ser-622 Ser-623 Thr-625 Thr-651 Thr-652 Ser-685 Thr-694 Thr-726 Thr-739 Thr-760 Thr-779 Thr-801 Ser-806 Thr-808 Thr-861 Thr-1030 Thr-1031 Thr-1143 Ser-1150 Thr-1239 Thr-1273 Thr-1335 Thr-1743 Mass spectrometry observed peptide TGTTHTATTATSNGGTGQPE (20aa) P51610 Thr-1335 Host Cell Factor 1 / Homo sapiens
Thr-1743	O-Linked / O-GlcNAc	HexNAc:1	taxonomy (1) protein (1) source (1) structure (1) composition (1) disease (0) reference (1) site (30) peptide (1) Taxonomy Homo sapiens (Human) Protein Host Cell Factor 1 / Homo sapiens P51610 Source HEK293 (CVCL_0045) Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Electron Transfer Dissociation (ETD): The Mass Spectrometric Breakthrough Essential for O-GlcNAc Protein Site Assignments-A Study of the O-GlcNAcylated Protein Host Cell Factor C1 (2013 - Samuel A Myers, Salima Daou, El Bachir Affar, Al Burlingame) / Status : Reviewed Reported glycosite Host Cell Factor 1 / Homo sapiens Thr-490 Thr-495 Ser-562 Ser-563 Ser-569 Thr-579 Ser-620 Ser-622 Ser-623 Thr-625 Thr-651 Thr-652 Ser-685 Thr-694 Thr-726 Thr-739 Thr-760 Thr-779 Thr-801 Ser-806 Thr-808 Thr-861 Thr-1030 Thr-1031 Thr-1143 Ser-1150 Thr-1239 Thr-1273 Thr-1335 Thr-1743 Mass spectrometry observed peptide LAGTVPSTVALLPSTATE (18aa) P51610 Thr-1743 Host Cell Factor 1 / Homo sapiens

← Previous
Displaying 1 to 30 of 30
Next →

Show 50 per page

Host Cell Factor 1 (Homo sapiens)

All glycosylation sites

Taxonomy

Protein

Source

Reported structure

Composition

Disease

Reference

Reported glycosite

Mass spectrometry observed peptide

Taxonomy

Protein

Source

Reported structure

Composition

Disease

Reference

Reported glycosite

Mass spectrometry observed peptide

Taxonomy

Protein

Source

Reported structure

Composition

Disease

Reference

Reported glycosite

Mass spectrometry observed peptide

Taxonomy

Protein

Source

Reported structure

Composition

Disease

Reference

Reported glycosite

Mass spectrometry observed peptide

Taxonomy

Protein

Source

Reported structure

Composition

Disease

Reference

Reported glycosite

Mass spectrometry observed peptide

Taxonomy

Protein

Source

Reported structure

Composition

Disease

Reference

Reported glycosite

Mass spectrometry observed peptide

Taxonomy

Protein

Source

Reported structure

Composition

Disease

Reference

Reported glycosite

Mass spectrometry observed peptide

Taxonomy

Protein

Source

Reported structure

Composition

Disease

Reference

Reported glycosite

Mass spectrometry observed peptide

Taxonomy

Protein

Source

Reported structure

Composition

Disease