taxonomy (1)
protein (43)
source (13)
structure (411)
composition (177)
disease (21)
reference (63)
site (105)
peptide (98)
- Homo sapiens (Human)
Taxonomy
- Immunoglobulin alpha (non secretory) / Homo sapiens P01877 P01876
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens P0DOX2
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens P0DOX2
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens P0DOX2
- Immunoglobulin epsilon chain c region / Homo sapiens P01854
- Immunoglobulin gamma / Homo sapiens P01859 P01861 P01857 P01860
- Immunoglobulin gamma-1 heavy chain / Homo sapiens P0DOX5
- Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(g) / monoclonal) / Homo sapiens P01860
- Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(s) / monoclonal) / Homo sapiens P01860
- Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
- Immunoglobulin gamma-3-[da265] (anti-nip antibody) / Homo sapiens
- Immunoglobulin gamma-3-[fa241] (anti-nip antibody) / Homo sapiens
- Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens P01860
- Immunoglobulin gamma-3-[ra301] (anti-nip antibody) / Homo sapiens
- Immunoglobulin gamma-3-[va264] (anti-nip antibody) / Homo sapiens
- Immunoglobulin gamma-3-[ya296] (anti-nip antibody) / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens P01877
- Immunoglobulin heavy constant delta / Homo sapiens P01880
- Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens P01880
- Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens P01880
- Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens P01854
- Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens P01854
- Immunoglobulin heavy constant gamma 1 / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 3 / Homo sapiens P01860
- Immunoglobulin heavy constant gamma 4 / Homo sapiens P01861
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Immunoglobulin heavy variable 3/OR16-8 (non-functional) / Homo sapiens A0A075B7F1
- Immunoglobulin heavy variable 4-39 / Homo sapiens P01824
- Immunoglobulin J chain / Homo sapiens P01591
- Immunoglobulin kappa chain V-I region CAR / Homo sapiens P01596
- Immunoglobulin lambda-1 light chain / Homo sapiens P0DOX8
- Immunoglobulin superfamily containing leucine-rich repeat protein / Homo sapiens O14498
- Immunoglobulin superfamily DCC subclass member 4 / Homo sapiens Q8TDY8
- Immunoglobulin superfamily member 3 / Homo sapiens O75054
- Immunoglobulin superfamily member 5 / Homo sapiens Q9NSI5
- Immunoglobulin superfamily member 8 / Homo sapiens Q969P0
Protein
- Blood (UBERON_0000178)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Colostrum (UBERON_0001914)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO-K1 (CVCL_0214)
- Urine (UBERON_0001088)
- HEK293-F (CVCL_6642)
- HEK293T (CVCL_0063)
- Lymphocyte (CL_0000542)
- Cerebrospinal Fluid Secretion (GO_0033326)
Source
- N-Linked / Complex / Structure 10936
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ GlcNAc(b1-?)"
- N-Linked / Complex / Structure 10893
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 1850
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 1994
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 9831
- N-Linked / Complex / GlcNAc(?1-?)Man(a1-3)[GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 9533
- N-Linked / Complex / Structure 10940
- N-Linked / Complex / Structure 10950
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 1497
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10949
- N-Linked / Complex / GlcNAc(?1-?)Man(a1-3)[GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-4)][Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 2643
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 2011
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 9500
- N-Linked / Complex / Structure 10889
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 9446
- N-Linked / Complex / Structure 10152
- N-Linked / Complex / Structure 10208
- N-Linked / Complex / Structure 10920
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 10891
- N-Linked / Complex / Structure 10924
- N-Linked / Complex / Structure 9501
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 2719
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9835
- N-Linked / Complex / Structure 10128
- N-Linked / Complex / Structure 10309
- N-Linked / Complex / Structure 10933
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-?)Man(a1-3)[Gal(b1-4)GlcNAc(b1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-?)GlcNAc(b1-?)Man(a1-3)[Gal(b1-?)GlcNAc(b1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 2888
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9460
- N-Linked / Complex / Structure 10244
- N-Linked / Complex / Structure 824
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 2104
- N-Linked / Complex / Structure 9418
- N-Linked / Complex / Structure 10145
- N-Linked / Complex / Structure 10292
- N-Linked / Complex / Structure 10885
- N-Linked / Complex / Structure 10902
- N-Linked / Complex / Structure 10945
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 2708
- N-Linked / Complex / Structure 10553
- N-Linked / Complex / Structure 10896
- N-Linked / Complex / Structure 9423
- N-Linked / Complex / Structure 231
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 9431
- N-Linked / Complex / Structure 10915
- N-Linked / Complex / Structure 9523
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-?)Man(a1-3)[Gal(b1-4)GlcNAc(b1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-?)GlcNAc(b1-?)Man(a1-3)[Gal(b1-?)GlcNAc(b1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
- N-Linked / Complex / Structure 10951
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)"
- N-Linked / Complex / Structure 9520
- N-Linked / Complex / Structure 10049
- N-Linked / Complex / Structure 10169
- N-Linked / Complex / Structure 10199
- N-Linked / Complex / Structure 10207
- N-Linked / Complex / Structure 10216
- N-Linked / Complex / Structure 10310
- N-Linked / Complex / Structure 10934
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 1147
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-?)Man(a1-3)[Gal(b1-4)GlcNAc(b1-?)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 1586
- N-Linked / Complex / Structure 2950
- N-Linked / Complex / Gal(b1-?)GlcNAc(b1-?)Man(a1-3)[Gal(b1-?)GlcNAc(b1-?)Man(a1-6)][GlcNAc(b1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 9474
- N-Linked / Complex / Structure 10909
- N-Linked / Complex / Structure 10912
- N-Linked / Complex / Structure 10159
- N-Linked / Complex / Structure 10200
- N-Linked / Complex / Structure 9545
- N-Linked / Complex / Structure 908
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9469
- N-Linked / Complex / Structure 10250
- N-Linked / Complex / Structure 10302
- N-Linked / Complex / Structure 10914
- N-Linked / Complex / Structure 10917
- N-Linked / Complex / Structure 10943
- N-Linked / Complex / Structure 10954
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ NeuAc"
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 1344
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 3507
- N-Linked / Complex / Structure 10153
- N-Linked / Complex / Structure 10246
- N-Linked / Complex / Structure 10290
- N-Linked / Complex / Structure 10895
- N-Linked / Complex / Structure 10916
- N-Linked / Complex / Structure 32
- N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-3)[Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 10944
- N-Linked / Complex / Structure 9507
- N-Linked / Complex / Structure 2437
- N-Linked / Complex / Structure 9430
- N-Linked / Complex / Structure 10223
- N-Linked / Complex / Structure 10499
- N-Linked / Complex / Structure 10887
- N-Linked / Complex / Structure 9481
- N-Linked / Complex / Structure 10206
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-?)Man(a1-3)[Gal(b1-4)GlcNAc(b1-?)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 2489
- N-Linked / Complex / Gal(b1-?)GlcNAc(b1-?)Man(a1-3)[Gal(b1-?)GlcNAc(b1-?)Man(a1-6)][GlcNAc(b1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x Gal(b1-4)"
- N-Linked / Complex / Structure 3446
- N-Linked / Complex / Structure 9453
- N-Linked / Complex / Structure 644
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 10148
- N-Linked / Complex / Structure 10189
- N-Linked / Complex / Structure 1523
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc"
- N-Linked / Complex / NeuAc(?2-?)Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[Gal(?1-?)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10167
- N-Linked / Complex / Structure 10184
- N-Linked / Complex / Structure 10186
- N-Linked / Complex / Structure 10197
- N-Linked / Complex / Structure 10293
- N-Linked / Complex / Structure 10948
- N-Linked / Complex / Structure 10952
- N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-6)[Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9390
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9511
- N-Linked / Complex / Structure 10020
- N-Linked / Complex / Structure 10174
- N-Linked / Complex / Structure 10191
- N-Linked / Complex / Structure 10935
- N-Linked / Complex / Structure 10937
- N-Linked / Complex / Structure 289
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 9374
- N-Linked / Complex / Structure 10248
- N-Linked / Complex / Structure 10938
- N-Linked / Complex / Structure 10947
- N-Linked / Complex / Structure 9540
- N-Linked / Complex / Structure 923
- N-Linked / Complex / Structure 9385
- N-Linked / Complex / Structure 10229
- N-Linked / Complex / Structure 10903
- N-Linked / Complex / Structure 9537
- N-Linked / Complex / Structure 10166
- N-Linked / Complex / Structure 10283
- N-Linked / Complex / Structure 10305
- N-Linked / Complex / NeuAc(?2-?)Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[NeuAc(?2-?)Gal(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 10303
- N-Linked / Complex / Structure 10304
- N-Linked / Complex / Structure 9425
- N-Linked / Complex / Structure 10906
- N-Linked / Complex / Structure 10946
- N-Linked / Complex / Structure 9394
- N-Linked / Complex / Structure 1149
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9487
- N-Linked / Complex / Structure 9892
- N-Linked / Complex / Structure 10203
- N-Linked / Complex / Structure 10227
- N-Linked / Complex / Structure 10231
- N-Linked / Complex / Structure 10264
- N-Linked / Complex / Structure 10910
- N-Linked / Complex / Structure 10918
- N-Linked / Complex / Structure 10955
- N-Linked / Complex / Structure 9454
- N-Linked / Complex / Structure 10929
- N-Linked / Complex / Structure 10899
- N-Linked / Complex / Structure 10146
- N-Linked / Complex / Structure 10198
- N-Linked / Complex / Structure 10288
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3) + NeuAc(a2-6)"
- N-Linked / Complex / Neu?c(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Neu?c(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(?2-?)Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[NeuAc(?2-?)Gal(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / Structure 1519
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10160
- N-Linked / Complex / Structure 10275
- N-Linked / Complex / Structure 9372
- N-Linked / Complex / Structure 9498
- N-Linked / Complex / Structure 10942
- N-Linked / Complex / Structure 432
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 9466
- N-Linked / Complex / Structure 10185
- N-Linked / Complex / Structure 10957
- N-Linked / Complex / Structure 2089
- N-Linked / Complex / Structure 9499
- N-Linked / Complex / Structure 10151
- N-Linked / Complex / Structure 10155
- N-Linked / Complex / Structure 10251
- N-Linked / Complex / Structure 10296
- N-Linked / Complex / Structure 10941
- N-Linked / Complex / Structure 10907
- N-Linked / Complex / Structure 10931
- N-Linked / Complex / Structure 10225
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10123
- N-Linked / Complex / Structure 10217
- N-Linked / Complex / Structure 350
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9542
- N-Linked / Complex / Structure 10131
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x NeuAc(a2-3)"
- N-Linked / Complex / Structure 10898
- N-Linked / Complex / Structure 10908
- N-Linked / Complex / Structure 10926
- N-Linked / Complex / Structure 10932
- N-Linked / Complex / Structure 10170
- N-Linked / Complex / Structure 10173
- N-Linked / Complex / Structure 10249
- N-Linked / Complex / Structure 10278
- N-Linked / Complex / Structure 10179
- N-Linked / Complex / Structure 1712
- N-Linked / Complex / Structure 10232
- N-Linked / Complex / Structure 10888
- N-Linked / Complex / Structure 10897
- N-Linked / Complex / Structure 10913
- N-Linked / Complex / Structure 138
- N-Linked / Complex / Structure 10158
- N-Linked / Complex / Structure 10247
- N-Linked / Complex / Structure 10156
- N-Linked / Complex / Structure 10171
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 10956
- N-Linked / Complex / Structure 10308
- N-Linked / Complex / Structure 10137
- N-Linked / Complex / Structure 10182
- N-Linked / Complex / Structure 10905
- N-Linked / Complex / Structure 1342
- N-Linked / Complex / Structure 10149
- N-Linked / Complex / Structure 10193
- N-Linked / Complex / Structure 10243
- N-Linked / Complex / Structure 10927
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man"
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Man"
- N-Linked / High-Mannose / Structure 3374
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-?)[Man(a1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x Man"
- N-Linked / High-Mannose / Structure 2601
- N-Linked / High-Mannose / Structure 3485
- N-Linked / High-Mannose / Structure 3609
- N-Linked / High-Mannose / Structure 10138
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(a1-2)"
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 4 x Man"
- N-Linked / High-Mannose / Structure 314
- N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-?)[Man(a1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(a1-2)"
- N-Linked / High-Mannose / Structure 3572
- N-Linked / High-Mannose / Structure 10291
- N-Linked / High-Mannose / Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)[Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-?)[Man(a1-?)]Man(a1-?)[Man(a1-2)Man(a1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Structure 2364
- N-Linked / High-Mannose / Structure 2636
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Man(a1-2)"
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 5 x Man"
- N-Linked / High-Mannose / Structure 10300
- N-Linked / High-Mannose / Structure 10930
- N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 6 x Man"
- N-Linked / High-Mannose / Structure 3677
- N-Linked / High-Mannose / Structure 9447
- N-Linked / High-Mannose / Structure 10029
- N-Linked / High-Mannose / Structure 10261
- N-Linked / High-Mannose / Structure 10277
- N-Linked / High-Mannose / Structure 10904
- N-Linked / High-Mannose / Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Structure 9534
- N-Linked / High-Mannose / Structure 10285
- N-Linked / High-Mannose / Structure 10922
- N-Linked / Hybrid / Structure 9536
- N-Linked / Hybrid / Structure 10263
- N-Linked / Hybrid / Structure 9371
- N-Linked / Hybrid / Structure 1713
- N-Linked / Hybrid / Man(a1-3)[Man(a1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 9492
- N-Linked / Hybrid / Structure 10205
- N-Linked / Hybrid / Structure 9488
- N-Linked / Hybrid / Structure 9535
- N-Linked / Hybrid / Man(a1-3)[Man(a1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Hybrid / Structure 9493
- N-Linked / Hybrid / Structure 10267
- N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 9403
- N-Linked / Hybrid / Structure 10953
- N-Linked / Hybrid / Structure 9459
- N-Linked / Hybrid / Structure 10925
- N-Linked / Hybrid / Structure 9476
- N-Linked / Hybrid / Structure 9647
- N-Linked / Hybrid / Structure 10196
- N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Hybrid / Structure 9426
- N-Linked / Hybrid / Structure 10144
- N-Linked / Hybrid / Structure 10178
- N-Linked / Hybrid / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 9526
- N-Linked / Hybrid / Structure 10886
- N-Linked / Hybrid / Structure 9399
- N-Linked / Hybrid / Structure 9746
- N-Linked / Hybrid / Structure 10252
- N-Linked / No-core / Fuc(a1-6)[GlcNAc(b1-4)]GlcNAc
- N-Linked / No-core / Man(a1-?)Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / No-core / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(a1-3)[Man(a1-2)Man(a1-6)]Man(b1-4)GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Pauci-Mannose / Structure 1786
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ GlcNAc"
- N-Linked / Undefined core / HexNAc(??-?)Hex(??-?)[Hex(??-?)]Hex(??-?)HexNAc(??-?)[Fuc(??-?)]HexNAc
- N-Linked / Undefined core / Man(?1-3)Man(?1-3)Man(?1-3)Man(?1-?)GlcNAc(?1-?)GlcNAc(?1-?)GlcNAc
- N-Linked / Undefined core / HexNAc(??-?)Hex(??-?)[HexNAc(??-?)][Hex(??-?)]Hex(??-?)HexNAc(??-?)[Fuc(??-?)]HexNAc
- N-Linked / Undefined core / HexNAc(??-?)Hex(??-?)[HexNAc(??-?)Hex(??-?)]Hex(??-?)HexNAc(??-?)[Fuc(??-?)]HexNAc
- N-Linked / Undefined core / Hex(??-?)HexNAc(??-?)Hex(??-?)[HexNAc(??-?)Hex(??-?)]Hex(??-?)HexNAc(??-?)HexNAc
- N-Linked / Undefined core / Structure 9886
- N-Linked / Undefined core / Hex(??-?)HexNAc(??-?)Hex(??-?)[HexNAc(??-?)Hex(??-?)]Hex(??-?)HexNAc(??-?)[Fuc(??-?)]HexNAc
- N-Linked / Undefined core / HexNAc(??-?)Hex(??-?)[HexNAc(??-?)Hex(??-?)][HexNAc(??-?)]Hex(??-?)HexNAc(??-?)[Fuc(??-?)]HexNAc
- N-Linked / Undefined core / NeuAc(??-?)Hex(??-?)HexNAc(??-?)Hex(??-?)[Hex(??-?)HexNAc(??-?)Hex(??-?)]Hex(??-?)HexNAc(??-?)HexNAc
- N-Linked / Undefined core / NeuAc(?2-?)Gal(b1-?)GlcNAc(?1-?)[NeuAc(?2-?)Gal(b1-?)GlcNAc(b1-?)Man(?1-?)]Man(?1-?)[GlcNAc(?1-?)]Man(?1-?)[Fuc(?1-?)]GlcNAc
- O-Linked / Core 0 / GalNAc
- O-Linked / Core 1 / Gal(b1-3)GalNAc
- O-Linked / Core 1 / Gal(b1-3)[NeuAc(a2-6)]GalNAc
- O-Linked / Core 1 / Gal(b1-3)GalNAc(a + "Neu5Ac(a"
- O-Linked / Core 1 / NeuAc(?2-?)Gal(b1-3)GalNAc
- O-Linked / Core 1 / NeuAc(a2-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Neu5Ac(?2-?)Gal(b1-3)[Neu5Ac(?2-?)]GalNAc(a1-
- O-Linked / Core 1 / NeuAc(a2-3)Gal(b1-3)[NeuAc(a2-6)]GalNAc
- O-Linked / Core 1 / Structure 10127
- O-Linked / Core 1 / Structure 10140
- O-Linked / Core 2 / Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Structure 10074
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Structure 10079
- O-Linked / Core 2 / Gal(b1-3)GlcNAc(b1-3)Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-3)GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Gal(b1-3)GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-4)[Gal(b1-3)]GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)[Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-6)]Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 8 / Gal(a1-3)GalNAc
- O-Linked / Undefined core / Gal(?1-3)GalNAc
- O-Linked / Undefined core / Gal(?1-3)GalNAc+"+ NeuAc(?2-?)"
- O-Linked / Undefined core / NeuAc(a2-3)Gal(?1-6)GlcNAc(b1-?)GlcNAc(b1-?)Gal(b1-?)Gal(b1-?)GalNAc
Reported structure
- HexNAc:1 (avg mass : 221.2103 )
- HexNAc:2 dHex:1 (avg mass : 570.5483 )
- Hex:1 HexNAc:1 (avg mass : 383.3527 )
- Hex:1 HexNAc:1 NeuAc:1 (avg mass : 674.6106 )
- Hex:1 HexNAc:1 NeuAc:2 (avg mass : 965.8685 )
- Hex:1 HexNAc:2 (avg mass : 586.5477 )
- Hex:1 HexNAc:2 NeuAc:1 (avg mass : 877.8056 )
- Hex:1 HexNAc:3 NeuAc:1 (avg mass : 1081.0006 )
- Hex:2 HexNAc:2 (avg mass : 748.6901 )
- Hex:2 HexNAc:2 NeuAc:1 (avg mass : 1039.948 )
- Hex:2 HexNAc:2 NeuAc:2 (avg mass : 1331.2059 )
- Hex:2 HexNAc:2 dHex:1 (avg mass : 894.8331 )
- Hex:2 HexNAc:2 dHex:1 NeuAc:1 (avg mass : 1186.091 )
- Hex:2 HexNAc:3 (avg mass : 951.8851 )
- Hex:2 HexNAc:3 NeuAc:1 (avg mass : 1243.143 )
- Hex:2 HexNAc:3 dHex:1 (avg mass : 1098.0281 )
- Hex:2 HexNAc:4 (avg mass : 1155.0801 )
- Hex:3 HexNAc:2 (avg mass : 910.8325 )
- Hex:3 HexNAc:2 dHex:1 (avg mass : 1056.9755 )
- Hex:3 HexNAc:3 (avg mass : 1114.0275 )
- Hex:3 HexNAc:3 NeuAc:1 (avg mass : 1405.2854 )
- Hex:3 HexNAc:3 NeuAc:2 (avg mass : 1696.5433 )
- Hex:3 HexNAc:3 dHex:1 (avg mass : 1260.1705 )
- Hex:3 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 1551.4284 )
- Hex:3 HexNAc:3 dHex:1 NeuAc:4 (avg mass : 2425.2021 )
- Hex:3 HexNAc:4 (avg mass : 1317.2225 )
- Hex:3 HexNAc:4 NeuAc:1 (avg mass : 1608.4804 )
- Hex:3 HexNAc:4 NeuAc:2 (avg mass : 1899.7383 )
- Hex:3 HexNAc:4 dHex:1 (avg mass : 1463.3655 )
- Hex:3 HexNAc:4 dHex:2 (avg mass : 1609.5085 )
- Hex:3 HexNAc:4 dHex:2 NeuAc:1 (avg mass : 1900.7664 )
- Hex:3 HexNAc:5 (avg mass : 1520.4175 )
- Hex:3 HexNAc:5 dHex:1 (avg mass : 1666.5605 )
- Hex:3 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 1957.8184 )
- Hex:3 HexNAc:5 dHex:2 (avg mass : 1812.7035 )
- Hex:3 HexNAc:6 (avg mass : 1723.6125 )
- Hex:3 HexNAc:6 dHex:1 (avg mass : 1869.7555 )
- Hex:3 HexNAc:6 dHex:2 (avg mass : 2015.8985 )
- Hex:3 HexNAc:6 dHex:2 NeuAc:1 (avg mass : 2307.1564 )
- Hex:3 HexNAc:6 dHex:3 (avg mass : 2162.0415 )
- Hex:4 HexNAc:2 (avg mass : 1072.9749 )
- Hex:4 HexNAc:2 dHex:1 (avg mass : 1219.1179 )
- Hex:4 HexNAc:3 (avg mass : 1276.1699 )
- Hex:4 HexNAc:3 NeuAc:1 (avg mass : 1567.4278 )
- Hex:4 HexNAc:3 NeuAc:3 (avg mass : 2149.9436 )
- Hex:4 HexNAc:3 dHex:1 (avg mass : 1422.3129 )
- Hex:4 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 1713.5708 )
- Hex:4 HexNAc:3 dHex:2 (avg mass : 1568.4559 )
- Hex:4 HexNAc:3 dHex:3 (avg mass : 1714.5989 )
- Hex:4 HexNAc:3 dHex:3 NeuAc:1 (avg mass : 2005.8568 )
- Hex:4 HexNAc:4 (avg mass : 1479.3649 )
- Hex:4 HexNAc:4 NeuAc:1 (avg mass : 1770.6228 )
- Hex:4 HexNAc:4 NeuAc:2 (avg mass : 2061.8807 )
- Hex:4 HexNAc:4 dHex:1 (avg mass : 1625.5079 )
- Hex:4 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 1916.7658 )
- Hex:4 HexNAc:4 dHex:2 (avg mass : 1771.6509 )
- Hex:4 HexNAc:4 dHex:2 NeuAc:1 (avg mass : 2062.9088 )
- Hex:4 HexNAc:4 dHex:3 NeuAc:1 (avg mass : 2209.0518 )
- Hex:4 HexNAc:5 (avg mass : 1682.5599 )
- Hex:4 HexNAc:5 NeuAc:1 (avg mass : 1973.8178 )
- Hex:4 HexNAc:5 NeuAc:1 NeuGc:1 (avg mass : 2281.0751 )
- Hex:4 HexNAc:5 dHex:1 (avg mass : 1828.7029 )
- Hex:4 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2119.9608 )
- Hex:4 HexNAc:5 dHex:2 (avg mass : 1974.8459 )
- Hex:4 HexNAc:5 dHex:2 NeuAc:1 (avg mass : 2266.1038 )
- Hex:4 HexNAc:6 (avg mass : 1885.7549 )
- Hex:4 HexNAc:6 NeuAc:1 (avg mass : 2177.0128 )
- Hex:4 HexNAc:6 dHex:1 (avg mass : 2031.8979 )
- Hex:4 HexNAc:6 dHex:2 (avg mass : 2178.0409 )
- Hex:4 HexNAc:7 NeuAc:1 (avg mass : 2380.2078 )
- Hex:4 HexNAc:7 dHex:1 (avg mass : 2235.0929 )
- Hex:5 HexNAc:2 (avg mass : 1235.1173 )
- Hex:5 HexNAc:2 dHex:1 (avg mass : 1381.2603 )
- Hex:5 HexNAc:3 (avg mass : 1438.3123 )
- Hex:5 HexNAc:3 NeuAc:1 (avg mass : 1729.5702 )
- Hex:5 HexNAc:3 dHex:1 (avg mass : 1584.4553 )
- Hex:5 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 1875.7132 )
- Hex:5 HexNAc:3 dHex:2 (avg mass : 1730.5983 )
- Hex:5 HexNAc:3 dHex:3 (avg mass : 1876.7413 )
- Hex:5 HexNAc:4 (avg mass : 1641.5073 )
- Hex:5 HexNAc:4 NeuAc:1 (avg mass : 1932.7652 )
- Hex:5 HexNAc:4 NeuAc:2 (avg mass : 2224.0231 )
- Hex:5 HexNAc:4 NeuAc:2 Su:1 (avg mass : 2304.0873 )
- Hex:5 HexNAc:4 dHex:1 (avg mass : 1787.6503 )
- Hex:5 HexNAc:4 dHex:1 Su:1 (avg mass : 1867.7145 )
- Hex:5 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 2078.9082 )
- Hex:5 HexNAc:4 dHex:1 NeuAc:1 Su:1 (avg mass : 2158.9724 )
- Hex:5 HexNAc:4 dHex:1 NeuAc:2 (avg mass : 2370.1661 )
- Hex:5 HexNAc:4 dHex:1 NeuAc:2 Ac:1 (avg mass : 2412.2028 )
- Hex:5 HexNAc:4 dHex:1 NeuAc:2 Su:1 (avg mass : 2450.2303 )
- Hex:5 HexNAc:4 dHex:2 (avg mass : 1933.7933 )
- Hex:5 HexNAc:4 dHex:2 NeuAc:1 (avg mass : 2225.0512 )
- Hex:5 HexNAc:4 dHex:2 NeuAc:2 (avg mass : 2516.3091 )
- Hex:5 HexNAc:4 dHex:3 (avg mass : 2079.9363 )
- Hex:5 HexNAc:4 dHex:3 NeuAc:1 (avg mass : 2371.1942 )
- Hex:5 HexNAc:4 dHex:4 (avg mass : 2226.0793 )
- Hex:5 HexNAc:5 (avg mass : 1844.7023 )
- Hex:5 HexNAc:5 NeuAc:1 (avg mass : 2135.9602 )
- Hex:5 HexNAc:5 NeuAc:2 (avg mass : 2427.2181 )
- Hex:5 HexNAc:5 dHex:1 (avg mass : 1990.8453 )
- Hex:5 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2282.1032 )
- Hex:5 HexNAc:5 dHex:1 NeuAc:2 (avg mass : 2573.3611 )
- Hex:5 HexNAc:5 dHex:2 (avg mass : 2136.9883 )
- Hex:5 HexNAc:5 dHex:2 NeuAc:1 (avg mass : 2428.2462 )
- Hex:5 HexNAc:5 dHex:3 (avg mass : 2283.1313 )
- Hex:5 HexNAc:5 dHex:3 NeuAc:1 (avg mass : 2574.3892 )
- Hex:5 HexNAc:6 (avg mass : 2047.8973 )
- Hex:5 HexNAc:6 NeuAc:1 (avg mass : 2339.1552 )
- Hex:5 HexNAc:6 dHex:1 (avg mass : 2194.0403 )
- Hex:5 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2485.2982 )
- Hex:5 HexNAc:6 dHex:2 (avg mass : 2340.1833 )
- Hex:5 HexNAc:7 (avg mass : 2251.0923 )
- Hex:5 HexNAc:7 dHex:1 (avg mass : 2397.2353 )
- Hex:5 HexNAc:8 dHex:1 (avg mass : 2600.4303 )
- Hex:6 HexNAc:2 (avg mass : 1397.2597 )
- Hex:6 HexNAc:3 (avg mass : 1600.4547 )
- Hex:6 HexNAc:3 NeuAc:1 (avg mass : 1891.7126 )
- Hex:6 HexNAc:3 dHex:1 (avg mass : 1746.5977 )
- Hex:6 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 2037.8556 )
- Hex:6 HexNAc:3 dHex:2 (avg mass : 1892.7407 )
- Hex:6 HexNAc:3 dHex:3 (avg mass : 2038.8837 )
- Hex:6 HexNAc:4 (avg mass : 1803.6497 )
- Hex:6 HexNAc:4 NeuAc:1 (avg mass : 2094.9076 )
- Hex:6 HexNAc:4 NeuAc:2 (avg mass : 2386.1655 )
- Hex:6 HexNAc:4 dHex:1 (avg mass : 1949.7927 )
- Hex:6 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 2241.0506 )
- Hex:6 HexNAc:4 dHex:2 (avg mass : 2095.9357 )
- Hex:6 HexNAc:4 dHex:2 NeuAc:1 (avg mass : 2387.1936 )
- Hex:6 HexNAc:4 dHex:2 NeuAc:2 (avg mass : 2678.4515 )
- Hex:6 HexNAc:4 dHex:3 (avg mass : 2242.0787 )
- Hex:6 HexNAc:5 (avg mass : 2006.8447 )
- Hex:6 HexNAc:5 NeuAc:1 (avg mass : 2298.1026 )
- Hex:6 HexNAc:5 NeuAc:2 (avg mass : 2589.3605 )
- Hex:6 HexNAc:5 NeuAc:3 (avg mass : 2880.6184 )
- Hex:6 HexNAc:5 dHex:1 (avg mass : 2152.9877 )
- Hex:6 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2444.2456 )
- Hex:6 HexNAc:5 dHex:1 NeuAc:2 (avg mass : 2735.5035 )
- Hex:6 HexNAc:5 dHex:1 NeuAc:3 (avg mass : 3026.7614 )
- Hex:6 HexNAc:5 dHex:2 (avg mass : 2299.1307 )
- Hex:6 HexNAc:5 dHex:2 NeuAc:1 (avg mass : 2590.3886 )
- Hex:6 HexNAc:5 dHex:2 NeuAc:3 (avg mass : 3172.9044 )
- Hex:6 HexNAc:6 (avg mass : 2210.0397 )
- Hex:6 HexNAc:6 NeuAc:1 (avg mass : 2501.2976 )
- Hex:6 HexNAc:6 NeuAc:2 (avg mass : 2792.5555 )
- Hex:6 HexNAc:6 NeuAc:3 (avg mass : 3083.8134 )
- Hex:6 HexNAc:6 dHex:1 (avg mass : 2356.1827 )
- Hex:6 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2647.4406 )
- Hex:6 HexNAc:6 dHex:1 NeuAc:2 (avg mass : 2938.6985 )
- Hex:6 HexNAc:6 dHex:1 NeuAc:3 (avg mass : 3229.9564 )
- Hex:6 HexNAc:6 dHex:2 NeuAc:2 (avg mass : 3084.8415 )
- Hex:6 HexNAc:6 dHex:2 NeuAc:3 (avg mass : 3376.0994 )
- Hex:6 HexNAc:7 dHex:1 (avg mass : 2559.3777 )
- Hex:6 HexNAc:7 dHex:1 NeuAc:1 (avg mass : 2850.6356 )
- Hex:7 HexNAc:2 (avg mass : 1559.4021 )
- Hex:7 HexNAc:3 dHex:1 (avg mass : 1908.7401 )
- Hex:7 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 2199.998 )
- Hex:7 HexNAc:4 (avg mass : 1965.7921 )
- Hex:7 HexNAc:4 NeuAc:1 (avg mass : 2257.05 )
- Hex:7 HexNAc:4 dHex:1 (avg mass : 2111.9351 )
- Hex:7 HexNAc:5 dHex:1 (avg mass : 2315.1301 )
- Hex:7 HexNAc:6 (avg mass : 2372.1821 )
- Hex:7 HexNAc:6 NeuAc:3 (avg mass : 3245.9558 )
- Hex:7 HexNAc:6 NeuAc:4 (avg mass : 3537.2137 )
- Hex:7 HexNAc:6 dHex:1 (avg mass : 2518.3251 )
- Hex:7 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2809.583 )
- Hex:7 HexNAc:6 dHex:1 NeuAc:2 (avg mass : 3100.8409 )
- Hex:7 HexNAc:6 dHex:1 NeuAc:3 (avg mass : 3392.0988 )
- Hex:7 HexNAc:6 dHex:2 NeuAc:2 (avg mass : 3246.9839 )
- Hex:7 HexNAc:6 dHex:2 NeuAc:3 (avg mass : 3538.2418 )
- Hex:7 HexNAc:7 dHex:1 (avg mass : 2721.5201 )
- Hex:7 HexNAc:7 dHex:1 NeuAc:1 (avg mass : 3012.778 )
- Hex:7 HexNAc:7 dHex:1 NeuAc:2 (avg mass : 3304.0359 )
- Hex:8 HexNAc:2 (avg mass : 1721.5445 )
- Hex:9 HexNAc:2 (avg mass : 1883.6869 )
- Hex:10 HexNAc:2 (avg mass : 2045.8293 )
- Hex:10 HexNAc:6 dHex:1 (avg mass : 3004.7523 )
- Hex:12 HexNAc:2 (avg mass : 2370.1141 )
Composition
- Arthritis, Rheumatoid (DOID:7148)
- Asymptomatic myositis (DOID:633)
- Atopic dermatitis (DOID:3310)
- Cancer, breast (DOID:1612)
- Control/Healthy
- Dyscrasia, Plasma Cell (DOID:6536)
- Gastritis (DOID:4029)
- Heavy Chain Disease (DOID:0060125)
- Hyper IgE syndrome (DOID:0080545)
- Hyperimmune condition
- Hypersensitivity reaction disease (DOID:0060056)
- IgE myeloma (DOID:9538)
- Myeloma (DOID:0070004)
- Myeloma, Multiple (DOID:9538)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- Myositis (DOID:633)
- Oral squamous cell carcinoma (DOID:0050866)
- Prostate cancer (DOID:10283)
- Sjogren's Syndrome (DOID:12894)
- Systemic lupus erythematosus (DOID:9074)
- Waldenstrom Macroglobulinaemia (DOID:0060901)
Disease
- Community Evaluation of Glycoproteomics Informatics Solutions Reveals High-Performance Search Strategies for Glycopeptide Analysis (2021 - Rebeca Kawahara, Kathirvel Alagesan, Marshall Bern, Meng Bo, Weiqian Cao, Robert J Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet-Weiland, Mingqi Liu, Yehia Mechref, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Vakhrushev, Christina Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Zhang Yong, Hui Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Goran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, and Morten Thaysen-Andersen) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Tongue Cancer Patients Can be Distinguished from Healthy Controls by Specific N-Glycopeptides Found in Serum. (2018 - Mayank Saraswat, Antti Mäkitie, Tiialotta Tohmola, Amy Dickinson, Shruti Saraswat, Sakari Joenväärä, Suvi Renkonen) / Status : Reviewed
- A Microarray-Matrix-assisted Laser Desorption/Ionization-Mass Spectrometry Approach for Site-specific Protein N-glycosylation Analysis, as Demonstrated for Human Serum Immunoglobulin M (IgM) (2015 - Martin Pabst, Simon Karl Küster, Fabian Wahl, Jasmin Krismer, Petra S.Dittrich, Renato Zenobi) / Status : Reviewed
- A Method for Comprehensive Glycosite-Mapping and Direct Quantitation of Serum Glycoproteins (2015 - Qiuting Hong, L. Renee Ruhaak, Carol Stroble, Evan Parker, Jincui Huang, Emanual Maverakis, Carlito B. Lebrilla) / Status : Reviewed
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
- Comparison of separation techniques for the elucidation of IgG N-glycans pooled from healthy mammalian species (2014 - Barbara Adamczyk, Tharmala Tharmalingam-Jaikaran, Michael Schomberg, Ákos Szekrényes, Ronan M.Kelly, Niclas G.Karlsson, Andràs Guttman, Pauline M.Rudd) / Status : Reviewed
- Immunoglobulin G (IgG) Fab Glycosylation Analysis Using a New Mass Spectrometric High-throughput Profiling Method Reveals Pregnancy-associated Changes (2014 - Albert Bondt, Yoann Rombouts, Maurice H.J.Selman, Paul J.Hensbergen, Karli R.Reiding, Johanna M.W.Hazes, Radboud J.E.M.Dolhain, Manfred Wuhrer) / Status : Reviewed
- Hypomorphic homozygous mutations in phosphoglucomutase 3 (PGM3) impair immunity and increase serum IgE levels, (2014 - Atfa Sassi, Sandra Lazaroski, Gang Wu, Stuart M. Haslam, Manfred Fliegauf, Fethi Mellouli, Turkan Patiroglu, Ekrem Unal, Mehmet Akif Ozdemir, Zineb Jouhadi, Khadija Khadir, Leila Ben-Khemis, Meriem Ben-Ali, Imen Ben-Mustapha, Lamia Borchani, Dietmar Pfeifer, Thilo Jakob, Monia Khemiri, A. Charlotta Asplund, Manuela O. Gustafsson, Karin E. Lundin, Elin Falk-Sörqvist, Lotte N. Moens, Hatice Eke Gungor, Karin R. Engelhardt, Magdalena Dziadzio, Hans Stauss, Bernhard Fleckenstein, Rebecca Meier, Khairunnadiya Prayitno, Andrea Maul-Pavicic, Sandra Schaffer, Mirzokhid Rakhmanov, Philipp Henneke, Helene Kraus, Hermann Eibel, Uwe Kölsch, Sellama Nadifi, Mats Nilsson, Mohamed Bejaoui, Alejandro A. Schäffer, C.I. Edvard Smith, Anne Dell, Mohamed-Ridha Barbouche, Bodo Grimbacher) / Status : Reviewed
- Expression and glycoengineering of functionally active heteromultimeric IgM in plants (2014 - Loos A, Gruber C, Altmann F, Mehofer U, Hensel F, Grandits M, Oostenbrink C, Stadlmayr G, Furtmüller PG, Steinkellner H) / Status : Reviewed
- Comparison of sialylated N-glycopeptide levels in serum of pancreatic cancer patients, acute pancreatitis patients, and healthy controls (2014 - Kontro H, Joenväärä S, Haglund C, Renkonen R) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Absolute Quantitation of Immunoglobulin G and Its Glycoforms Using Multiple Reaction Monitoring (2013 - Qiuting Hong, Carlito B. Lebrilla, Suzanne Miyamoto, L. Renee Ruhaak) / Status : Reviewed
- Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
- Naturally Occurring Structural Isomers in Serum IgA1 O-Glycosylation (2012 - Kazuo Takahashi, Archer D. Smith, IV, Knud Poulsen, Mogens Kilian, Bruce A. Julian, Jiri Mestecky, Jan Novak, Matthew B. Renfrow) / Status : Reviewed
- Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD (2012 - Halim A, Nilsson J, Rüetschi U, Hesse C, Larson G) / Status : Reviewed
- Mass Spectrometric Determination of IgG Subclass-Specific Glycosylation Profiles in Siblings Discordant for Myositis Syndromes (2011 - Irina Perdivara, Shyamal D. Peddada, Frederick W. Miller, Kenneth B. Tomer, Leesa J. Deterding) / Status : Reviewed
- GlycoSpectrumScan: Fishing Glycopeptides from MS Spectra of Protease Digests of Human Colostrum sIgA (2010 - Nandan Deshpande, Pia H. Jensen, Nicolle H. Packer, Daniel Kolarich) / Status : Reviewed
- Enrichment of glycopeptides for glycan structure and attachment site identification (2009 - Nilsson J, Rüetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G.) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- Differential Glycosylation of Polymeric and Monomeric IgA: A Possible Role in Glomerular Inflammation in IgA Nephropathy (2006 - Beatrijs D. Oortwijn, Anja Roos, Louise Royle, Daniëlle J. van Gijlswijk-Janssen, Maria C. Faber-Krol, Jan-Willem Eijgenraam, Raymond A. Dwek, Mohamed R. Daha, Pauline M. Rudd, Cees van Kooten) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
- Structural studies on IgG oligosaccharides of patients with primary Sjogren's syndrome. (2002 - Kuroda Y, Nakata M, Makino A, Matsumoto A, Ohashi K, Itahashi K, Takeuchi F, Goto M, Kojima N, Mizuochi T) / Status : Reviewed
- Sialylation of human IgG-Fc carbohydrate by transfected rat alpha2,6-sialyltransferase (2001 - Jassal, Jenkins, Charlwood, Camilleri, Jefferis, Lund) / Status : Reviewed
- Control of bisecting GlcNAc addition to N-linked sugar chains. (2000 - Fukuta K, Abe R, Yokomatsu T, Omae F, Asanagi M, Makino T) / Status : Reviewed
- Comparative study of the N-glycans of human monoclonal immunoglobulins M produced by hybridoma and parental cells. (2000 - Fukuta K, Abe R, Yokomatsu T, Kono N, Nagatomi Y, Asanagi M, Shimazaki Y, Makino T) / Status : Reviewed
- Carbohydrate release from picomole quantities of glycoprotein and characterisation of glycans by high-performance liquid chromatography and mass spectrometry. (1999 - Charlwood J, Birrell H, Camilleri P) / Status : Reviewed
- The glycosylation and structure of human serum IgA1, Fab, and Fc regions and the role of N-glycosylation on Fc alpha receptor interactions. (1998 - Mattu T, Pleass R, Willis A, Kilian M, Wormald M, Lellouch A, Rudd P, Woof J, Dwek R) / Status : Reviewed
- Evidence for a site-specific fucosylation of N-linked oligosaccharide of immunoglobulin A1 from normal human serum. (1998 - Tanaka A, Iwase H, Hiki Y, Kokubo T, Ishii-Karakasa I, Toma K, Kobayashi Y, Hotta K) / Status : Reviewed
- Multiple interactions of IgG with its core oligosaccharide can modulate recognition by complement and human Fc gamma recpetor I and influence the synthesis of its oligosaccharide chains (1996 - Lund, Takahashi, Pound, Goodall, Jefferis) / Status : Reviewed
- The resolution of the neutral N-linked oligosaccharides of IgG by high pH anion-exchange chromatography. (1996 - McGuire J, Douglas M, Smith K) / Status : Reviewed
- Three-dimensional elution mapping of pyridylaminated N-linked neutral and sialyl oligosaccharides. (1995 - Takahashi N, Nakagawa H, Fujikawa K, Kawamura Y, Tomiya N) / Status : Reviewed
- A simple method for the release of asparagine-linked oligosaccharides from a glycoprotein purified by SDS-polyacrylamide gel electrophoresis. (1992 - Kawashima H, Murata T, Yamamoto K, Tateishi A, Irimura T, Osawa T) / Status : Reviewed
- Analysis of glycoform of O-glycan from human myeloma immunoglobulin A1 by gas-phase hydrazinolysis following pyridylamination of oligosaccharides. (1992 - Iwase H, Ishii-Karakasa I, Fujii E, Hotta K, Hiki Y, Kobayashi Y) / Status : Reviewed
- The conformational effects of N-glycosylation on the tailpiece from serum IgM. (1991 - Wormald M, Wooten E, Bazzo R, Edge C, Feinstein A, Rademacher T, Dwek R) / Status : Reviewed
- Structural heterogeneity of sugar chains in immunoglobulin G. Conformation of immunoglobulin G molecule and substrate specificities of glycosyltransferases. (1990 - Fujii S, Nishiura T, Nishikawa A, Miura R, Taniguchi N) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- O-linked oligosaccharides from human serum immunoglobulin A1. (1989 - Field M, Dwek R, Edge C, Rademacher T) / Status : Reviewed
- Primary structure of twenty three neutral and monosialylated oligosaccharides O-glycosidically linked to the human secretory immunoglobulin A hinge region determined by a combination of permethylation analysis and 400-MHz 1H-NMR spectroscopy. (1989 - Pierce-Cretel A, Decottignies J, Wieruszeski J, Strecker G, Montreuil J, Spik G) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
- Structural analysis of N-linked oligosaccharides by a combination of glycopeptidase, exoglycosidases, and high-performance liquid chromatography. (1987 - Tomiya N, Kurono M, Ishihara H, Tejima S, Endo S, Arata Y, Takahashi N) / Status : Reviewed
- Structures of the oligosaccharides present at the three asparagine-linked glycosylation sites of human IgD. (1983 - S J Mellis, J U Baenziger) / Status : Reviewed
- Structures of the O-glycosidically linked oligosaccharides of human IgD. (1983 - S J Mellis, J U Baenziger) / Status : Reviewed
- Structures of the O-glycosidically linked oligosaccharides of human IgD. (1983 - Mellis S, Baenziger J) / Status : Reviewed
- Heterogeneity of the glycans O-glycosidically linked to the hinge region of secretory immunoglobulins from human milk. (1981 - Pierce-Cretel A, Pamblanco M, Strecker G, Montreuil J, Spik G) / Status : Reviewed
- Structures of sialylated O-glycosidically and N-glycosidically linked oligosaccharides in a monoclonal immunoglobulin light chain. (1981 - Chandrasekaran EV, Mendicino A, Garver FA, Mendicino J) / Status : Reviewed
- Localization of the carbohydrate units in a human immunoglobulin light chain, protein Sm lambda. (1981 - Garver F, Chang L, Kiefer C, Mendicino J, Chandrasekaran E, Isobe T, Osserman E) / Status : Reviewed
- Structure of the oligosaccharide of human J chain. (1979 - Baenziger J) / Status : Reviewed
- Structure of the carbohydrate units of IgE immunoglobulin. I. Over-all composition, glycopeptide isolation, and structure of the high mannose oligosaccharide unit. (1974 - Baenziger J, Kornfeld S, Kochwa S) / Status : Reviewed
- Structure of the carbohydrate units of IgE immunoglobulin. II. Sequence of the sialic acid-containing glycopeptides. (1974 - Baenziger J, Kornfeld S, Kochwa S) / Status : Reviewed
- Structure of the carbohydrate units of IgA1 immunoglobulin. II. Stucture of the O-glycosidically linked oligosaccharide units. (1974 - Baenziger J, Kornfeld S) / Status : Reviewed
- Structure of the carbohydrate units of IgA1 immunoglobulin. I. Composition, glycopeptide isolation, and structure of the asparagine-linked oligosaccharide units. (1974 - Baenziger J, Kornfeld S) / Status : Reviewed
- Investigations on the oligosaccharide units of an A myeloma globulin. (1968 - Dawson G, Clamp JR) / Status : Reviewed
Reference
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
- Asn-144
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
- Immunoglobulin epsilon chain c region / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
- Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(g) / monoclonal) / Homo sapiens
- Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(s) / monoclonal) / Homo sapiens
-
Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[da265] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[fa241] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[ra301] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[va264] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[ya296] (anti-nip antibody) / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant delta / Homo sapiens
-
Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin heavy variable 3/OR16-8 (non-functional) / Homo sapiens
-
Immunoglobulin heavy variable 4-39 / Homo sapiens
- Undefined site
- Immunoglobulin J chain / Homo sapiens
- Immunoglobulin kappa chain V-I region CAR / Homo sapiens
- Immunoglobulin lambda-1 light chain / Homo sapiens
- Immunoglobulin superfamily containing leucine-rich repeat protein / Homo sapiens
- Immunoglobulin superfamily DCC subclass member 4 / Homo sapiens
- Immunoglobulin superfamily member 3 / Homo sapiens
- Immunoglobulin superfamily member 5 / Homo sapiens
- Immunoglobulin superfamily member 8 / Homo sapiens
Reported glycosite
- ASQNISSWLAWYQQK (15aa)
- KNNSDISSTRGFPSVLRGGKY (21aa)
- KYKNNSDISSTRG (13aa)
- KNNSDISSTRG (11aa)
- YKNNSDISSTR (11aa)
- NNSDISSTR (9aa)
- LVQGFFPQEPLSVTWSESGQNVTAR (25aa)
- VQGFFPQEPLSVTWSESGQNVTAR (24aa)
- SVTWSESGQNVTAR (14aa)
- VFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQNVTAR (44aa)
- ENISDPTSPLR (11aa)
- IIVPLNNRENISDPTSPLR (19aa)
- IIVPINNRENISDPTSPIR (19aa)
- RIIVPLNNRENISDPTSPLRT (21aa)
- RENISDPTSPLRT (13aa)
- RIIVPLNNRENISDPTSPLRTRF (23aa)
- HYTNSSQDVTVPCR (14aa)
- HYTNSSQDVTVPCRVPPPPPCCHPR (25aa)
- DNANNSPYLQMNSLR (15aa)
- HYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSPSCCHPR (38aa)
- P01876 Ser-105     Immunoglobulin heavy constant alpha 1 / Homo sapiens
- P01876 Ser-111     Immunoglobulin heavy constant alpha 1 / Homo sapiens
- P01876 Thr-109     Immunoglobulin heavy constant alpha 1 / Homo sapiens
- P01876 Thr-106     Immunoglobulin heavy constant alpha 1 / Homo sapiens
- P01876 Thr-117     Immunoglobulin heavy constant alpha 1 / Homo sapiens
- HYTNPSQDVTVPCPVPSTPPTPSP (24aa)
- P01876 Ser-111     Immunoglobulin heavy constant alpha 1 / Homo sapiens
- P01876 Ser-113     Immunoglobulin heavy constant alpha 1 / Homo sapiens
- P01876 Thr-109     Immunoglobulin heavy constant alpha 1 / Homo sapiens
- P01876 Thr-106     Immunoglobulin heavy constant alpha 1 / Homo sapiens
- STPPTPSPSCCHPR (14aa)
- SLDLSHNLISDFAWSDLHNLSALQLLK (27aa)
- SCDTPPPCPR (10aa)
- P01860 Thr-122     Immunoglobulin heavy constant gamma 3 / Homo sapiens
- P01860 Thr-152     Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(s) / monoclonal) / Homo sapiens
- P01860 Thr-137     Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(s) / monoclonal) / Homo sapiens
- P01860 Thr-152     Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(g) / monoclonal) / Homo sapiens
- P01860 Thr-137     Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(g) / monoclonal) / Homo sapiens
- P01860 Thr-122     Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(g) / monoclonal) / Homo sapiens
- P01860 Thr-122     Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(s) / monoclonal) / Homo sapiens
- P01860 Thr-152     Immunoglobulin heavy constant gamma 3 / Homo sapiens
- P01860 Thr-137     Immunoglobulin heavy constant gamma 3 / Homo sapiens
- PALEDLLLGSEANLTCTLTGLR (22aa)
- RLSLHRPALEDLLLGSEANLTCTLTGLRD (29aa)
- LSLHRPALEDLLLGSEANLTCTL (23aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- P01876 Asn-144     Immunoglobulin heavy constant alpha 1 / Homo sapiens
- P01877 Asn-144     Immunoglobulin alpha (non secretory) / Homo sapiens
- P01876 Asn-144     Immunoglobulin alpha (non secretory) / Homo sapiens
- P01877 Asn-131     Immunoglobulin heavy constant alpha 2 / Homo sapiens
- P01876 Asn-18     Immunoglobulin heavy constant alpha 1 / Homo sapiens
- LATLADFSLHPESQTVEENGTAR (23aa)
- TKPREEQFNSTFR (13aa)
- REEQFNSTFRV (11aa)
- EEQFNSTF (8aa)
- TKPREEQFNSTF (12aa)
- EEQFNSTFR (9aa)
- VAR_003892 226:Y→F
- P01859 Asn-176     Immunoglobulin heavy constant gamma 2 / Homo sapiens
- VAR_003892 226:Y→F
- P01859 Asn-227     Immunoglobulin heavy constant gamma 2 / Homo sapiens
- VAR_003892 226:Y→F
- VAR_003892 226:Y→F
- P01860 Asn-227     Immunoglobulin heavy constant gamma 3 / Homo sapiens
- VAR_003892 226:Y→F
- VAR_003892 226:Y→F
- KTKPREEQFNSTFRV (15aa)
- TKPREEQFNSTYR (13aa)
- EEQFNSTY (8aa)
- EEQFNSTYR (9aa)
- REEQYNSTYRV (11aa)
- EEQYNSTYR (9aa)
- TKPREEQYNSTY (12aa)
- TKPREEQYNSTYR (13aa)
- EEQYNSTYRVVSVLTVLHQDWLNGKEYK (28aa)
- EEQYNSTY (8aa)
- KTKPREEQYNSTYRV (15aa)
- EEQYNSTYRVVSVLTVLHQDWLNGK (25aa)
- EEQYNSTYR (10aa)
- KTPLTANITKS (11aa)
- TPLTANITK (9aa)
- GLTFQQNASSM(SO)CVPDQDTAIR (25aa)
- GLTFQQNASSMCGPDQDTAIR (21aa)
- GLTFQQNASSMCVPDQDTAIR (21aa)
- VDHRGLTFQQNASSMCGPDQDTAIR (25aa)
- RGLTFQQNASSMCVPDQDTAIRV (23aa)
- GITFQQNASSMCVPDQDTAIR (21aa)
- GLTFQQNASSM (11aa)
- EEQYNSTFR (9aa)
- SATVNLTVIR (10aa)
- THTNISE (7aa)
- THTNISESHPNATFSAVGEASICEDDWNSGER (32aa)
- THTNISESHPNATFSAVGEASICEDDWDSGER (32aa)
- NGTLTVTSTLPVGTR (15aa)
- SHPNATFSAVGE (12aa)
- FQAFANGSLLIPDFGK (16aa)
- GFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSK (39aa)
- AGKPTHVNVSVVMAEVDGTCY (21aa)
- MAGKPTHINVSVVMAEADGTCY (22aa)
- IGPGEPIEIICNVSGAIPPAGR (22aa)
- MAGKPTHVNVSVVMAEVDGTCY (22aa)
- AGKPTHVNVSV (11aa)
- LAGKPTHVNVSVV (13aa)
- LAGKPTHVNVSV (12aa)
- KTIDRLAGKPTHVNVSVVMAEVDGTCY (27aa)
- LAGKPTHVNVS (11aa)
- RLAGKPTHVNVSVVMAEVDGTCY (23aa)
- TIDRLAGKPTHVNVSVVMAEVDGTCY (26aa)
- LAGKPTHVNVSVVMAEVDGTCY (22aa)
- LAGKPTHVNVSVVMAE (16aa)
- LAGKPTHVNVSVVMAEVDGTC (21aa)
- LAGKPTHVNVSVVM (14aa)
- IAGKPTHVNVSVVMAEVDGTCY (22aa)
- KTIDRLAGKPTHVNVSVVMAEVDGTCY- (28aa)
- RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
- TLLNASR (7aa)
- KSTGKPTLYNVSLVMSDTAGTCY- (24aa)
- STGKPTLYNVSLV(MSO)SDTAGTCY (26aa)
- STGKPTLYNVSLVM (14aa)
- STGKPTLYNVSLVMSDTAGTCY (22aa)
- STGKPTLYNVSLVMSDTAGTC (21aa)
- STGKPTLYNVSL (12aa)
- GETASIICNISVR (13aa)
- GMDNVEYQFAVNNDTTELQVR (21aa)
- GNETQLMLNSLQPNK (15aa)
- TITIVENKPIQINCSVK (17aa)
- GPPLPPAHVHAESNSSTSIWLR (22aa)
- IVNYTVR (7aa)
- NASLVTYYTSSGEDILIGGLKPFTK (25aa)
- QVQIECVVINR (11aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 1098.0281)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1114.0275)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1114.0275)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1114.0275)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1260.1705)
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Undefined site
- Asn-176
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1260.1705)
- Control/Healthy
- Hypersensitivity reaction disease (DOID:0060056)
- Systemic lupus erythematosus (DOID:9074)
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
-
Immunoglobulin epsilon chain c region / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- RIIVPLNNRENISDPTSPLRT (21aa)
- KTKPREEQFNSTFRV (15aa)
-
- N-Linked / Complex
(avg mass : 1260.1705)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1276.1699)
- Blood Serum (UBERON_0001977)
-
Immunoglobulin epsilon chain c region / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1276.1699)
- Control/Healthy
- Myeloma, Multiple (DOID:9538)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1276.1699)
- Urine (UBERON_0001088)
- Heavy Chain Disease (DOID:0060125)
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1276.1699)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1317.2225)
- Asymptomatic myositis (DOID:633)
- Control/Healthy
- Myositis (DOID:633)
- Systemic lupus erythematosus (DOID:9074)
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
- Mass Spectrometric Determination of IgG Subclass-Specific Glycosylation Profiles in Siblings Discordant for Myositis Syndromes (2011 - Irina Perdivara, Shyamal D. Peddada, Frederick W. Miller, Kenneth B. Tomer, Leesa J. Deterding) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
- EEQFNSTFR (9aa)
- VAR_003892 226:Y→F
- P01859 Asn-176     Immunoglobulin heavy constant gamma 2 / Homo sapiens
- VAR_003892 226:Y→F
- P01859 Asn-227     Immunoglobulin heavy constant gamma 2 / Homo sapiens
- VAR_003892 226:Y→F
- VAR_003892 226:Y→F
- P01860 Asn-227     Immunoglobulin heavy constant gamma 3 / Homo sapiens
- VAR_003892 226:Y→F
- VAR_003892 226:Y→F
- EEQYNSTYR (9aa)
-
- N-Linked / Complex
(avg mass : 1317.2225)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Ovary (UBERON_0000992) CHO-K1 (CVCL_0214)
- Arthritis, Rheumatoid (DOID:7148)
- Control/Healthy
- Myeloma (DOID:0070004)
- Myeloma, Multiple (DOID:9538)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- Sjogren's Syndrome (DOID:12894)
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Comparison of separation techniques for the elucidation of IgG N-glycans pooled from healthy mammalian species (2014 - Barbara Adamczyk, Tharmala Tharmalingam-Jaikaran, Michael Schomberg, Ákos Szekrényes, Ronan M.Kelly, Niclas G.Karlsson, Andràs Guttman, Pauline M.Rudd) / Status : Reviewed
- Structural studies on IgG oligosaccharides of patients with primary Sjogren's syndrome. (2002 - Kuroda Y, Nakata M, Makino A, Matsumoto A, Ohashi K, Itahashi K, Takeuchi F, Goto M, Kojima N, Mizuochi T) / Status : Reviewed
- Sialylation of human IgG-Fc carbohydrate by transfected rat alpha2,6-sialyltransferase (2001 - Jassal, Jenkins, Charlwood, Camilleri, Jefferis, Lund) / Status : Reviewed
- Multiple interactions of IgG with its core oligosaccharide can modulate recognition by complement and human Fc gamma recpetor I and influence the synthesis of its oligosaccharide chains (1996 - Lund, Takahashi, Pound, Goodall, Jefferis) / Status : Reviewed
- Structural heterogeneity of sugar chains in immunoglobulin G. Conformation of immunoglobulin G molecule and substrate specificities of glycosyltransferases. (1990 - Fujii S, Nishiura T, Nishikawa A, Miura R, Taniguchi N) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[ya296] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
- Asn-180
-
Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Undefined site
- Asn-176
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1317.2225)
- Milk (UBERON_0001913)
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- KTKPREEQFNSTFRV (15aa)
- KTKPREEQYNSTYRV (15aa)
-
- N-Linked / Complex
(avg mass : 1405.2854)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1405.2854)
- Blood Plasma (UBERON_0001969)
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1422.3129)
- Control/Healthy
- Myeloma, Multiple (DOID:9538)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1422.3129)
- Blood Serum (UBERON_0001977)
-
Immunoglobulin epsilon chain c region / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1422.3129)
- Blood Plasma (UBERON_0001969)
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1422.3129)
- Blood Plasma (UBERON_0001969)
- Control/Healthy
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1463.3655)
- Blood Serum (UBERON_0001977)
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1463.3655)
- Blood Plasma (UBERON_0001969)
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1463.3655)
- Asymptomatic myositis (DOID:633)
- Atopic dermatitis (DOID:3310)
- Control/Healthy
- Gastritis (DOID:4029)
- Hyper IgE syndrome (DOID:0080545)
- Myositis (DOID:633)
- Systemic lupus erythematosus (DOID:9074)
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Immunoglobulin G (IgG) Fab Glycosylation Analysis Using a New Mass Spectrometric High-throughput Profiling Method Reveals Pregnancy-associated Changes (2014 - Albert Bondt, Yoann Rombouts, Maurice H.J.Selman, Paul J.Hensbergen, Karli R.Reiding, Johanna M.W.Hazes, Radboud J.E.M.Dolhain, Manfred Wuhrer) / Status : Reviewed
- Hypomorphic homozygous mutations in phosphoglucomutase 3 (PGM3) impair immunity and increase serum IgE levels, (2014 - Atfa Sassi, Sandra Lazaroski, Gang Wu, Stuart M. Haslam, Manfred Fliegauf, Fethi Mellouli, Turkan Patiroglu, Ekrem Unal, Mehmet Akif Ozdemir, Zineb Jouhadi, Khadija Khadir, Leila Ben-Khemis, Meriem Ben-Ali, Imen Ben-Mustapha, Lamia Borchani, Dietmar Pfeifer, Thilo Jakob, Monia Khemiri, A. Charlotta Asplund, Manuela O. Gustafsson, Karin E. Lundin, Elin Falk-Sörqvist, Lotte N. Moens, Hatice Eke Gungor, Karin R. Engelhardt, Magdalena Dziadzio, Hans Stauss, Bernhard Fleckenstein, Rebecca Meier, Khairunnadiya Prayitno, Andrea Maul-Pavicic, Sandra Schaffer, Mirzokhid Rakhmanov, Philipp Henneke, Helene Kraus, Hermann Eibel, Uwe Kölsch, Sellama Nadifi, Mats Nilsson, Mohamed Bejaoui, Alejandro A. Schäffer, C.I. Edvard Smith, Anne Dell, Mohamed-Ridha Barbouche, Bodo Grimbacher) / Status : Reviewed
- Absolute Quantitation of Immunoglobulin G and Its Glycoforms Using Multiple Reaction Monitoring (2013 - Qiuting Hong, Carlito B. Lebrilla, Suzanne Miyamoto, L. Renee Ruhaak) / Status : Reviewed
- Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
- Mass Spectrometric Determination of IgG Subclass-Specific Glycosylation Profiles in Siblings Discordant for Myositis Syndromes (2011 - Irina Perdivara, Shyamal D. Peddada, Frederick W. Miller, Kenneth B. Tomer, Leesa J. Deterding) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
-
Immunoglobulin epsilon chain c region / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
- Asn-46
- KNNSDISSTRG (11aa)
- REEQFNSTFRV (11aa)
- EEQFNSTFR (9aa)
- VAR_003892 226:Y→F
- P01859 Asn-176     Immunoglobulin heavy constant gamma 2 / Homo sapiens
- VAR_003892 226:Y→F
- P01859 Asn-227     Immunoglobulin heavy constant gamma 2 / Homo sapiens
- VAR_003892 226:Y→F
- VAR_003892 226:Y→F
- P01860 Asn-227     Immunoglobulin heavy constant gamma 3 / Homo sapiens
- VAR_003892 226:Y→F
- VAR_003892 226:Y→F
- KTKPREEQFNSTFRV (15aa)
- EEQYNSTYR (9aa)
- REEQYNSTYRV (11aa)
- KTKPREEQYNSTYRV (15aa)
- EEQYNSTYR (10aa)
- KTPLTANITKS (11aa)
-
- N-Linked / Complex
(avg mass : 1463.3655)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Ovary (UBERON_0000992) CHO-K1 (CVCL_0214)
- Arthritis, Rheumatoid (DOID:7148)
- Control/Healthy
- Myeloma (DOID:0070004)
- Myeloma, Multiple (DOID:9538)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- Sjogren's Syndrome (DOID:12894)
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Comparison of separation techniques for the elucidation of IgG N-glycans pooled from healthy mammalian species (2014 - Barbara Adamczyk, Tharmala Tharmalingam-Jaikaran, Michael Schomberg, Ákos Szekrényes, Ronan M.Kelly, Niclas G.Karlsson, Andràs Guttman, Pauline M.Rudd) / Status : Reviewed
- Structural studies on IgG oligosaccharides of patients with primary Sjogren's syndrome. (2002 - Kuroda Y, Nakata M, Makino A, Matsumoto A, Ohashi K, Itahashi K, Takeuchi F, Goto M, Kojima N, Mizuochi T) / Status : Reviewed
- Sialylation of human IgG-Fc carbohydrate by transfected rat alpha2,6-sialyltransferase (2001 - Jassal, Jenkins, Charlwood, Camilleri, Jefferis, Lund) / Status : Reviewed
- Multiple interactions of IgG with its core oligosaccharide can modulate recognition by complement and human Fc gamma recpetor I and influence the synthesis of its oligosaccharide chains (1996 - Lund, Takahashi, Pound, Goodall, Jefferis) / Status : Reviewed
- A simple method for the release of asparagine-linked oligosaccharides from a glycoprotein purified by SDS-polyacrylamide gel electrophoresis. (1992 - Kawashima H, Murata T, Yamamoto K, Tateishi A, Irimura T, Osawa T) / Status : Reviewed
- Structural heterogeneity of sugar chains in immunoglobulin G. Conformation of immunoglobulin G molecule and substrate specificities of glycosyltransferases. (1990 - Fujii S, Nishiura T, Nishikawa A, Miura R, Taniguchi N) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[da265] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[fa241] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[ra301] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[va264] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[ya296] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
- Asn-180
-
Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Undefined site
- Asn-176
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Asymptomatic myositis (DOID:633)
- Control/Healthy
- Hypersensitivity reaction disease (DOID:0060056)
- Myositis (DOID:633)
- Systemic lupus erythematosus (DOID:9074)
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- Absolute Quantitation of Immunoglobulin G and Its Glycoforms Using Multiple Reaction Monitoring (2013 - Qiuting Hong, Carlito B. Lebrilla, Suzanne Miyamoto, L. Renee Ruhaak) / Status : Reviewed
- Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
- Mass Spectrometric Determination of IgG Subclass-Specific Glycosylation Profiles in Siblings Discordant for Myositis Syndromes (2011 - Irina Perdivara, Shyamal D. Peddada, Frederick W. Miller, Kenneth B. Tomer, Leesa J. Deterding) / Status : Reviewed
- Differential Glycosylation of Polymeric and Monomeric IgA: A Possible Role in Glomerular Inflammation in IgA Nephropathy (2006 - Beatrijs D. Oortwijn, Anja Roos, Louise Royle, Daniëlle J. van Gijlswijk-Janssen, Maria C. Faber-Krol, Jan-Willem Eijgenraam, Raymond A. Dwek, Mohamed R. Daha, Pauline M. Rudd, Cees van Kooten) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
Immunoglobulin epsilon chain c region / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
- EEQFNSTFR (9aa)
- VAR_003892 226:Y→F
- P01859 Asn-176     Immunoglobulin heavy constant gamma 2 / Homo sapiens
- VAR_003892 226:Y→F
- P01859 Asn-227     Immunoglobulin heavy constant gamma 2 / Homo sapiens
- VAR_003892 226:Y→F
- VAR_003892 226:Y→F
- P01860 Asn-227     Immunoglobulin heavy constant gamma 3 / Homo sapiens
- VAR_003892 226:Y→F
- VAR_003892 226:Y→F
- EEQYNSTYR (9aa)
- EEQYNSTYR (10aa)
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Ovary (UBERON_0000992) CHO-K1 (CVCL_0214)
- Arthritis, Rheumatoid (DOID:7148)
- Control/Healthy
- Myeloma (DOID:0070004)
- Myeloma, Multiple (DOID:9538)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- Sjogren's Syndrome (DOID:12894)
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Structural studies on IgG oligosaccharides of patients with primary Sjogren's syndrome. (2002 - Kuroda Y, Nakata M, Makino A, Matsumoto A, Ohashi K, Itahashi K, Takeuchi F, Goto M, Kojima N, Mizuochi T) / Status : Reviewed
- Multiple interactions of IgG with its core oligosaccharide can modulate recognition by complement and human Fc gamma recpetor I and influence the synthesis of its oligosaccharide chains (1996 - Lund, Takahashi, Pound, Goodall, Jefferis) / Status : Reviewed
- Structural heterogeneity of sugar chains in immunoglobulin G. Conformation of immunoglobulin G molecule and substrate specificities of glycosyltransferases. (1990 - Fujii S, Nishiura T, Nishikawa A, Miura R, Taniguchi N) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[ya296] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
- Asn-180
-
Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Undefined site
- Asn-176
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Ovary (UBERON_0000992) CHO-K1 (CVCL_0214)
- Urine (UBERON_0001088)
- Arthritis, Rheumatoid (DOID:7148)
- Control/Healthy
- Heavy Chain Disease (DOID:0060125)
- Myeloma (DOID:0070004)
- Myeloma, Multiple (DOID:9538)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- Sjogren's Syndrome (DOID:12894)
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Structural studies on IgG oligosaccharides of patients with primary Sjogren's syndrome. (2002 - Kuroda Y, Nakata M, Makino A, Matsumoto A, Ohashi K, Itahashi K, Takeuchi F, Goto M, Kojima N, Mizuochi T) / Status : Reviewed
- Multiple interactions of IgG with its core oligosaccharide can modulate recognition by complement and human Fc gamma recpetor I and influence the synthesis of its oligosaccharide chains (1996 - Lund, Takahashi, Pound, Goodall, Jefferis) / Status : Reviewed
- The resolution of the neutral N-linked oligosaccharides of IgG by high pH anion-exchange chromatography. (1996 - McGuire J, Douglas M, Smith K) / Status : Reviewed
- Structural heterogeneity of sugar chains in immunoglobulin G. Conformation of immunoglobulin G molecule and substrate specificities of glycosyltransferases. (1990 - Fujii S, Nishiura T, Nishikawa A, Miura R, Taniguchi N) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
- Structures of the oligosaccharides present at the three asparagine-linked glycosylation sites of human IgD. (1983 - S J Mellis, J U Baenziger) / Status : Reviewed
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[ya296] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant delta / Homo sapiens
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
- Asn-180
-
Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Undefined site
- Asn-176
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Ovary (UBERON_0000992) CHO-K1 (CVCL_0214)
-
Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Milk (UBERON_0001913)
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- RENISDPTSPLRT (13aa)
- RLSLHRPALEDLLLGSEANLTCTLTGLRD (29aa)
- REEQYNSTYRV (11aa)
- KTKPREEQYNSTYRV (15aa)
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Blood Plasma (UBERON_0001969)
- Control/Healthy
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1520.4175)
- Blood Plasma (UBERON_0001969)
-
Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1520.4175)
- Control/Healthy
- Myeloma, Multiple (DOID:9538)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1520.4175)
- Milk (UBERON_0001913)
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- RIIVPLNNRENISDPTSPLRT (21aa)
- RENISDPTSPLRT (13aa)
- RLSLHRPALEDLLLGSEANLTCTLTGLRD (29aa)
- KTKPREEQYNSTYRV (15aa)
- RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
-
- N-Linked / Complex
(avg mass : 1520.4175)
- Control/Healthy
- Gastritis (DOID:4029)
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- GlycoSpectrumScan: Fishing Glycopeptides from MS Spectra of Protease Digests of Human Colostrum sIgA (2010 - Nandan Deshpande, Pia H. Jensen, Nicolle H. Packer, Daniel Kolarich) / Status : Reviewed
- Differential Glycosylation of Polymeric and Monomeric IgA: A Possible Role in Glomerular Inflammation in IgA Nephropathy (2006 - Beatrijs D. Oortwijn, Anja Roos, Louise Royle, Daniëlle J. van Gijlswijk-Janssen, Maria C. Faber-Krol, Jan-Willem Eijgenraam, Raymond A. Dwek, Mohamed R. Daha, Pauline M. Rudd, Cees van Kooten) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
- Asn-144
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- P01876 Asn-144     Immunoglobulin heavy constant alpha 1 / Homo sapiens
- P01877 Asn-144     Immunoglobulin alpha (non secretory) / Homo sapiens
- P01876 Asn-144     Immunoglobulin alpha (non secretory) / Homo sapiens
- P01877 Asn-131     Immunoglobulin heavy constant alpha 2 / Homo sapiens
- P01876 Asn-18     Immunoglobulin heavy constant alpha 1 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1520.4175)
- Blood Serum (UBERON_0001977)
- Control/Healthy
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1551.4284)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1567.4278)
- Blood Plasma (UBERON_0001969)
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1567.4278)
- Blood Plasma (UBERON_0001969)
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1567.4278)
- Blood Plasma (UBERON_0001969)
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1609.5085)
- Milk (UBERON_0001913)
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- KTKPREEQYNSTYRV (15aa)
-
- N-Linked / Complex
(avg mass : 1625.5079)
- Blood Serum (UBERON_0001977)
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1625.5079)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Ovary (UBERON_0000992) CHO-K1 (CVCL_0214)
- Arthritis, Rheumatoid (DOID:7148)
- Control/Healthy
- Myeloma (DOID:0070004)
- Myeloma, Multiple (DOID:9538)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- Sjogren's Syndrome (DOID:12894)
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Comparison of separation techniques for the elucidation of IgG N-glycans pooled from healthy mammalian species (2014 - Barbara Adamczyk, Tharmala Tharmalingam-Jaikaran, Michael Schomberg, Ákos Szekrényes, Ronan M.Kelly, Niclas G.Karlsson, Andràs Guttman, Pauline M.Rudd) / Status : Reviewed
- Structural studies on IgG oligosaccharides of patients with primary Sjogren's syndrome. (2002 - Kuroda Y, Nakata M, Makino A, Matsumoto A, Ohashi K, Itahashi K, Takeuchi F, Goto M, Kojima N, Mizuochi T) / Status : Reviewed
- Multiple interactions of IgG with its core oligosaccharide can modulate recognition by complement and human Fc gamma recpetor I and influence the synthesis of its oligosaccharide chains (1996 - Lund, Takahashi, Pound, Goodall, Jefferis) / Status : Reviewed
- A simple method for the release of asparagine-linked oligosaccharides from a glycoprotein purified by SDS-polyacrylamide gel electrophoresis. (1992 - Kawashima H, Murata T, Yamamoto K, Tateishi A, Irimura T, Osawa T) / Status : Reviewed
- Structural heterogeneity of sugar chains in immunoglobulin G. Conformation of immunoglobulin G molecule and substrate specificities of glycosyltransferases. (1990 - Fujii S, Nishiura T, Nishikawa A, Miura R, Taniguchi N) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[da265] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[fa241] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[ra301] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[va264] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[ya296] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
- Asn-180
-
Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Undefined site
- Asn-176
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1625.5079)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Ovary (UBERON_0000992) CHO-K1 (CVCL_0214)
- Arthritis, Rheumatoid (DOID:7148)
- Control/Healthy
- Myeloma (DOID:0070004)
- Myeloma, Multiple (DOID:9538)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- Sjogren's Syndrome (DOID:12894)
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Comparison of separation techniques for the elucidation of IgG N-glycans pooled from healthy mammalian species (2014 - Barbara Adamczyk, Tharmala Tharmalingam-Jaikaran, Michael Schomberg, Ákos Szekrényes, Ronan M.Kelly, Niclas G.Karlsson, Andràs Guttman, Pauline M.Rudd) / Status : Reviewed
- Structural studies on IgG oligosaccharides of patients with primary Sjogren's syndrome. (2002 - Kuroda Y, Nakata M, Makino A, Matsumoto A, Ohashi K, Itahashi K, Takeuchi F, Goto M, Kojima N, Mizuochi T) / Status : Reviewed
- Multiple interactions of IgG with its core oligosaccharide can modulate recognition by complement and human Fc gamma recpetor I and influence the synthesis of its oligosaccharide chains (1996 - Lund, Takahashi, Pound, Goodall, Jefferis) / Status : Reviewed
- A simple method for the release of asparagine-linked oligosaccharides from a glycoprotein purified by SDS-polyacrylamide gel electrophoresis. (1992 - Kawashima H, Murata T, Yamamoto K, Tateishi A, Irimura T, Osawa T) / Status : Reviewed
- Structural heterogeneity of sugar chains in immunoglobulin G. Conformation of immunoglobulin G molecule and substrate specificities of glycosyltransferases. (1990 - Fujii S, Nishiura T, Nishikawa A, Miura R, Taniguchi N) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[da265] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[fa241] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[ra301] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[va264] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[ya296] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
- Asn-180
-
Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Undefined site
- Asn-176
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1625.5079)
- Asymptomatic myositis (DOID:633)
- Control/Healthy
- Hypersensitivity reaction disease (DOID:0060056)
- Myositis (DOID:633)
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- A Method for Comprehensive Glycosite-Mapping and Direct Quantitation of Serum Glycoproteins (2015 - Qiuting Hong, L. Renee Ruhaak, Carol Stroble, Evan Parker, Jincui Huang, Emanual Maverakis, Carlito B. Lebrilla) / Status : Reviewed
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- Immunoglobulin G (IgG) Fab Glycosylation Analysis Using a New Mass Spectrometric High-throughput Profiling Method Reveals Pregnancy-associated Changes (2014 - Albert Bondt, Yoann Rombouts, Maurice H.J.Selman, Paul J.Hensbergen, Karli R.Reiding, Johanna M.W.Hazes, Radboud J.E.M.Dolhain, Manfred Wuhrer) / Status : Reviewed
- Absolute Quantitation of Immunoglobulin G and Its Glycoforms Using Multiple Reaction Monitoring (2013 - Qiuting Hong, Carlito B. Lebrilla, Suzanne Miyamoto, L. Renee Ruhaak) / Status : Reviewed
- Mass Spectrometric Determination of IgG Subclass-Specific Glycosylation Profiles in Siblings Discordant for Myositis Syndromes (2011 - Irina Perdivara, Shyamal D. Peddada, Frederick W. Miller, Kenneth B. Tomer, Leesa J. Deterding) / Status : Reviewed
- Differential Glycosylation of Polymeric and Monomeric IgA: A Possible Role in Glomerular Inflammation in IgA Nephropathy (2006 - Beatrijs D. Oortwijn, Anja Roos, Louise Royle, Daniëlle J. van Gijlswijk-Janssen, Maria C. Faber-Krol, Jan-Willem Eijgenraam, Raymond A. Dwek, Mohamed R. Daha, Pauline M. Rudd, Cees van Kooten) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
Immunoglobulin epsilon chain c region / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
- Immunoglobulin J chain / Homo sapiens
- RIIVPLNNRENISDPTSPLRT (21aa)
- REEQFNSTFRV (11aa)
- EEQFNSTFR (9aa)
- VAR_003892 226:Y→F
- P01859 Asn-176     Immunoglobulin heavy constant gamma 2 / Homo sapiens
- VAR_003892 226:Y→F
- P01859 Asn-227     Immunoglobulin heavy constant gamma 2 / Homo sapiens
- VAR_003892 226:Y→F
- VAR_003892 226:Y→F
- P01860 Asn-227     Immunoglobulin heavy constant gamma 3 / Homo sapiens
- VAR_003892 226:Y→F
- VAR_003892 226:Y→F
- KTKPREEQFNSTFRV (15aa)
- REEQYNSTYRV (11aa)
- EEQYNSTYR (9aa)
- KTKPREEQYNSTYRV (15aa)
- EEQYNSTYR (10aa)
-
- N-Linked / Complex
(avg mass : 1625.5079)
- Ovary (UBERON_0000992) CHO-K1 (CVCL_0214)
-
Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1625.5079)
- A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
- Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
- Immunoglobulin epsilon chain c region / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1625.5079)
- Blood Serum (UBERON_0001977)
-
Immunoglobulin epsilon chain c region / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1625.5079)
- A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
- Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
- Immunoglobulin epsilon chain c region / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1625.5079)
- Blood Plasma (UBERON_0001969)
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1641.5073)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Colostrum (UBERON_0001914)
- Milk (UBERON_0001913)
- Cerebrospinal Fluid Secretion (GO_0033326)
- Asymptomatic myositis (DOID:633)
- Control/Healthy
- Hyperimmune condition
- Hypersensitivity reaction disease (DOID:0060056)
- Myositis (DOID:633)
- Systemic lupus erythematosus (DOID:9074)
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- A Microarray-Matrix-assisted Laser Desorption/Ionization-Mass Spectrometry Approach for Site-specific Protein N-glycosylation Analysis, as Demonstrated for Human Serum Immunoglobulin M (IgM) (2015 - Martin Pabst, Simon Karl Küster, Fabian Wahl, Jasmin Krismer, Petra S.Dittrich, Renato Zenobi) / Status : Reviewed
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
- Absolute Quantitation of Immunoglobulin G and Its Glycoforms Using Multiple Reaction Monitoring (2013 - Qiuting Hong, Carlito B. Lebrilla, Suzanne Miyamoto, L. Renee Ruhaak) / Status : Reviewed
- Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
- Mass Spectrometric Determination of IgG Subclass-Specific Glycosylation Profiles in Siblings Discordant for Myositis Syndromes (2011 - Irina Perdivara, Shyamal D. Peddada, Frederick W. Miller, Kenneth B. Tomer, Leesa J. Deterding) / Status : Reviewed
- GlycoSpectrumScan: Fishing Glycopeptides from MS Spectra of Protease Digests of Human Colostrum sIgA (2010 - Nandan Deshpande, Pia H. Jensen, Nicolle H. Packer, Daniel Kolarich) / Status : Reviewed
- Enrichment of glycopeptides for glycan structure and attachment site identification (2009 - Nilsson J, Rüetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G.) / Status : Reviewed
- Differential Glycosylation of Polymeric and Monomeric IgA: A Possible Role in Glomerular Inflammation in IgA Nephropathy (2006 - Beatrijs D. Oortwijn, Anja Roos, Louise Royle, Daniëlle J. van Gijlswijk-Janssen, Maria C. Faber-Krol, Jan-Willem Eijgenraam, Raymond A. Dwek, Mohamed R. Daha, Pauline M. Rudd, Cees van Kooten) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
- Immunoglobulin epsilon chain c region / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
- Asn-46
- Immunoglobulin J chain / Homo sapiens
- YKNNSDISSTR (11aa)
- NNSDISSTR (9aa)
- ENISDPTSPLR (11aa)
- RIIVPLNNRENISDPTSPLRT (21aa)
- RENISDPTSPLRT (13aa)
- RLSLHRPALEDLLLGSEANLTCTLTGLRD (29aa)
- EEQFNSTFR (9aa)
- VAR_003892 226:Y→F
- P01859 Asn-176     Immunoglobulin heavy constant gamma 2 / Homo sapiens
- VAR_003892 226:Y→F
- P01859 Asn-227     Immunoglobulin heavy constant gamma 2 / Homo sapiens
- VAR_003892 226:Y→F
- VAR_003892 226:Y→F
- P01860 Asn-227     Immunoglobulin heavy constant gamma 3 / Homo sapiens
- VAR_003892 226:Y→F
- VAR_003892 226:Y→F
- EEQYNSTYR (9aa)
- KTKPREEQYNSTYRV (15aa)
- EEQYNSTYR (10aa)
-
- N-Linked / Complex
(avg mass : 1641.5073)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Ovary (UBERON_0000992) CHO-K1 (CVCL_0214)
- Urine (UBERON_0001088)
- Arthritis, Rheumatoid (DOID:7148)
- Control/Healthy
- Heavy Chain Disease (DOID:0060125)
- Myeloma (DOID:0070004)
- Myeloma, Multiple (DOID:9538)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- Sjogren's Syndrome (DOID:12894)
- Waldenstrom Macroglobulinaemia (DOID:0060901)
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Structural studies on IgG oligosaccharides of patients with primary Sjogren's syndrome. (2002 - Kuroda Y, Nakata M, Makino A, Matsumoto A, Ohashi K, Itahashi K, Takeuchi F, Goto M, Kojima N, Mizuochi T) / Status : Reviewed
- Sialylation of human IgG-Fc carbohydrate by transfected rat alpha2,6-sialyltransferase (2001 - Jassal, Jenkins, Charlwood, Camilleri, Jefferis, Lund) / Status : Reviewed
- Evidence for a site-specific fucosylation of N-linked oligosaccharide of immunoglobulin A1 from normal human serum. (1998 - Tanaka A, Iwase H, Hiki Y, Kokubo T, Ishii-Karakasa I, Toma K, Kobayashi Y, Hotta K) / Status : Reviewed
- Multiple interactions of IgG with its core oligosaccharide can modulate recognition by complement and human Fc gamma recpetor I and influence the synthesis of its oligosaccharide chains (1996 - Lund, Takahashi, Pound, Goodall, Jefferis) / Status : Reviewed
- Structural heterogeneity of sugar chains in immunoglobulin G. Conformation of immunoglobulin G molecule and substrate specificities of glycosyltransferases. (1990 - Fujii S, Nishiura T, Nishikawa A, Miura R, Taniguchi N) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
- Structures of the oligosaccharides present at the three asparagine-linked glycosylation sites of human IgD. (1983 - S J Mellis, J U Baenziger) / Status : Reviewed
- Structure of the oligosaccharide of human J chain. (1979 - Baenziger J) / Status : Reviewed
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[da265] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[fa241] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens
- Undefined site
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1641.5073)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1641.5073)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1625.5079)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1625.5079)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1625.5079)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1625.5079)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1625.5079)
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1625.5079)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1625.5079)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1625.5079)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1625.5079)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1609.5085)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1567.4278)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1567.4278)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1567.4278)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1551.4284)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1520.4175)
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1520.4175)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1520.4175)
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1520.4175)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1520.4175)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1479.3649)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1479.3649)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1479.3649)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1479.3649)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1479.3649)
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1479.3649)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1463.3655)
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1463.3655)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1463.3655)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1463.3655)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1422.3129)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1422.3129)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1422.3129)
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1422.3129)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1405.2854)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1405.2854)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1317.2225)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1317.2225)
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1317.2225)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1276.1699)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1276.1699)
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1276.1699)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1276.1699)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1260.1705)
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1260.1705)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1260.1705)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1114.0275)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1114.0275)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1114.0275)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1098.0281)