taxonomy (3)
protein (9)
source (1)
structure (157)
composition (107)
disease (0)
reference (11)
site (10)
peptide (4)
- Lactotransferrin / Homo sapiens P02788
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens P07288
- Uncharacterized protein from Seminal Fluid / Homo sapiens
- Uncharacterized protein from Seminal Fluid / Homo sapiens
- Unspecified mucin / Homo sapiens
- Seminal plasma protein pdc-109 / Bos taurus P02784
- Major seminal plasma glycoprotein psp-i / Sus scrofa P35495
- Major seminal plasma glycoprotein psp-ii / Sus scrofa P35496
Protein
- Seminal Fluid (UBERON_0006530)
Source
- Free / Lactosamine / Fuc(a1-3)[Gal(b1-4)]GlcNAc
- Free / Lactose / Gal(b1-4)Glc
- Free / Lactose / Fuc(a1-3)[Gal(b1-4)]Glc
- Free / Lactose / Fuc(a1-2)Gal(b1-4)[Fuc(a1-3)]Glc
- Free / No-core / Fuc(a1-2)Gal(b1-4)[Fuc(a1-3)]GlcNAc
- Free / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-3)Glc
- Free / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-4)Glc
- Free / No-core / Fuc(a1-2)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Glc
- Free / No-core / Fuc(a1-2)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-4)Glc
- Free / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Glc
- Free / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-4)Glc
- Free / No-core / Fuc(a1-2)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Glc
- Free / No-core / Fuc(a1-2)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-4)Glc
- Free / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-4)[Fuc(a1-3)]Glc
- Free / No-core / Fuc(a1-2)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-4)[Fuc(a1-3)]Glc
- N-Linked / Complex / Structure 1850
- N-Linked / Complex / Structure 9563
- N-Linked / Complex / Structure 9828
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9720
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(b1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9812
- N-Linked / Complex / Structure 10991
- N-Linked / Complex / Structure 9854
- N-Linked / Complex / Structure 10964
- N-Linked / Complex / Structure 9686
- N-Linked / Complex / Structure 9725
- N-Linked / Complex / Structure 10970
- N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9739
- N-Linked / Complex / Fuc(a1-3)[GalNAc(b1-4)]GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9699
- N-Linked / Complex / Structure 10972
- N-Linked / Complex / Gal(b1-4)GlcNAc(?1-?)Man(a1-3)[Gal(b1-4)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 10981
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9566
- N-Linked / Complex / Structure 9554
- N-Linked / Complex / Structure 10988
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9844
- N-Linked / Complex / Structure 9859
- N-Linked / Complex / Structure 10999
- N-Linked / Complex / NeuAc(a2-6)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9602
- N-Linked / Complex / Structure 10998
- N-Linked / Complex / Structure 9845
- N-Linked / Complex / Structure 10975
- N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9876
- N-Linked / Complex / Structure 10985
- N-Linked / Complex / Structure 9586
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9768
- N-Linked / Complex / Structure 10965
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10968
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9879
- N-Linked / Complex / Structure 10983
- N-Linked / Complex / Structure 9846
- N-Linked / Complex / Structure 10967
- N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-6)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9742
- N-Linked / Complex / Structure 11000
- N-Linked / Complex / Structure 9615
- N-Linked / Complex / Structure 10980
- N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9762
- N-Linked / Complex / Structure 10986
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9624
- N-Linked / Complex / Structure 9652
- N-Linked / Complex / Structure 10994
- N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9695
- N-Linked / Complex / Structure 9788
- N-Linked / Complex / Structure 10987
- N-Linked / Complex / Structure 10977
- N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Fuc(a1-3)[GalNAc(b1-4)]GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-6)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9675
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 9581
- N-Linked / Complex / Structure 9807
- N-Linked / Complex / Structure 9867
- N-Linked / Complex / Structure 10989
- N-Linked / Complex / Structure 10976
- N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9648
- N-Linked / Complex / Structure 9824
- N-Linked / Complex / Structure 10995
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Fuc(a1-3)[GalNAc(b1-4)]GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10974
- N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10992
- N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuGc(a2-6)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Gal(b1-4)GlcNAc(b1-4)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Neu?c(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Neu?c(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9679
- N-Linked / Complex / Structure 9801
- N-Linked / Complex / Structure 9880
- N-Linked / Complex / Structure 10971
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9599
- N-Linked / Complex / Structure 9823
- N-Linked / Complex / Structure 10982
- N-Linked / Complex / Structure 10978
- N-Linked / Complex / Structure 10966
- N-Linked / Complex / NeuAc(a2-6)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-6)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10969
- N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-4)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10973
- N-Linked / Complex / Structure 10997
- N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-6)[GlcNAc(b1-4)GlcNAc(b1-3)]Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-3)[Gal(a1-3)Gal(b1-4)GlcNAc(b1-6)]Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man"
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Man"
- N-Linked / High-Mannose / Structure 11001
- N-Linked / Hybrid / Structure 9669
- N-Linked / Hybrid / Structure 9644
- N-Linked / Hybrid / Structure 10993
- N-Linked / Hybrid / Gal(b1-3)GalNAc(b1-4)GlcNAc(?1-?)[GlcNAc(?1-?)]Man(a1-?)[Man(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Hybrid / Structure 10990
- N-Linked / Hybrid / Structure 10979
- N-Linked / Hybrid / NeuAc(a2-6)Gal(b1-3)GalNAc(b1-4)GlcNAc(?1-?)[GlcNAc(?1-?)]Man(a1-?)[Man(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Hybrid / Structure 10996
- N-Linked / No-core / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- O-Linked / Core 1 / Gal(b1-3)GalNAc
- O-Linked / Core 1 / Fuc(a1-2)Gal(b1-3)GalNAc
- O-Linked / Core 1 / NeuAc(a2-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / NeuAc(a2-6)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Fuc(a1-2)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Glc
- O-Linked / Core 1 / Fuc(a1-2)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-4)Glc
- O-Linked / Core 1 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Fuc(a1-2)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 2 / Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 6 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)GalNAc
- O-Linked / No-core / Gal(b1-4)GlcNAc
- O-Linked / Undefined core / NeuAc(?2-3)Gal(?1-3)[Fuc(?1-4)]GlcNAc(?1-3)Gal(?1-3)GalNAc
Reported structure
- Hex:1 HexNAc:1 (avg mass : 383.3527 )
- Hex:1 HexNAc:1 NeuAc:1 (avg mass : 674.6106 )
- Hex:1 HexNAc:1 dHex:1 (avg mass : 529.4957 )
- Hex:1 HexNAc:1 dHex:2 (avg mass : 675.6387 )
- Hex:1 HexNAc:2 (avg mass : 586.5477 )
- Hex:1 HexNAc:2 dHex:1 (avg mass : 732.6907 )
- Hex:2 (avg mass : 342.3001 )
- Hex:2 dHex:1 (avg mass : 488.4431 )
- Hex:2 dHex:2 (avg mass : 634.5861 )
- Hex:2 HexNAc:1 dHex:1 (avg mass : 691.6381 )
- Hex:2 HexNAc:1 dHex:2 (avg mass : 837.7811 )
- Hex:2 HexNAc:2 (avg mass : 748.6901 )
- Hex:2 HexNAc:2 NeuAc:1 (avg mass : 1039.948 )
- Hex:2 HexNAc:2 dHex:1 (avg mass : 894.8331 )
- Hex:2 HexNAc:2 dHex:1 NeuAc:1 (avg mass : 1186.091 )
- Hex:2 HexNAc:2 dHex:2 (avg mass : 1040.9761 )
- Hex:2 HexNAc:2 dHex:2 NeuAc:1 (avg mass : 1332.234 )
- Hex:3 HexNAc:2 dHex:1 (avg mass : 1056.9755 )
- Hex:3 HexNAc:2 dHex:2 (avg mass : 1203.1185 )
- Hex:3 HexNAc:2 dHex:3 (avg mass : 1349.2615 )
- Hex:3 HexNAc:2 dHex:4 (avg mass : 1495.4045 )
- Hex:3 HexNAc:3 dHex:1 (avg mass : 1260.1705 )
- Hex:3 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 1551.4284 )
- Hex:3 HexNAc:4 (avg mass : 1317.2225 )
- Hex:3 HexNAc:4 NeuAc:1 (avg mass : 1608.4804 )
- Hex:3 HexNAc:4 dHex:1 (avg mass : 1463.3655 )
- Hex:3 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 1754.6234 )
- Hex:3 HexNAc:4 dHex:2 (avg mass : 1609.5085 )
- Hex:3 HexNAc:5 NeuGc:1 (avg mass : 1827.6748 )
- Hex:3 HexNAc:5 NeuAc:1 (avg mass : 1811.6754 )
- Hex:3 HexNAc:5 dHex:1 (avg mass : 1666.5605 )
- Hex:3 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 1957.8184 )
- Hex:3 HexNAc:6 NeuAc:1 (avg mass : 2014.8704 )
- Hex:3 HexNAc:6 dHex:1 (avg mass : 1869.7555 )
- Hex:3 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2161.0134 )
- Hex:3 HexNAc:6 dHex:1 NeuAc:2 (avg mass : 2452.2713 )
- Hex:4 HexNAc:2 (avg mass : 1072.9749 )
- Hex:4 HexNAc:3 (avg mass : 1276.1699 )
- Hex:4 HexNAc:3 NeuAc:1 (avg mass : 1567.4278 )
- Hex:4 HexNAc:3 dHex:1 (avg mass : 1422.3129 )
- Hex:4 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 1713.5708 )
- Hex:4 HexNAc:3 dHex:2 (avg mass : 1568.4559 )
- Hex:4 HexNAc:4 (avg mass : 1479.3649 )
- Hex:4 HexNAc:4 NeuAc:1 (avg mass : 1770.6228 )
- Hex:4 HexNAc:4 dHex:1 (avg mass : 1625.5079 )
- Hex:4 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 1916.7658 )
- Hex:4 HexNAc:5 (avg mass : 1682.5599 )
- Hex:4 HexNAc:5 NeuAc:1 (avg mass : 1973.8178 )
- Hex:4 HexNAc:5 NeuAc:2 (avg mass : 2265.0757 )
- Hex:4 HexNAc:5 dHex:1 (avg mass : 1828.7029 )
- Hex:4 HexNAc:5 dHex:1 Su:1 (avg mass : 1908.7671 )
- Hex:4 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2119.9608 )
- Hex:4 HexNAc:5 dHex:1 NeuAc:2 (avg mass : 2411.2187 )
- Hex:4 HexNAc:5 dHex:2 NeuAc:1 (avg mass : 2266.1038 )
- Hex:4 HexNAc:6 NeuAc:1 (avg mass : 2177.0128 )
- Hex:4 HexNAc:6 NeuAc:2 (avg mass : 2468.2707 )
- Hex:4 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2323.1558 )
- Hex:4 HexNAc:6 dHex:2 NeuAc:1 (avg mass : 2469.2988 )
- Hex:5 HexNAc:2 (avg mass : 1235.1173 )
- Hex:5 HexNAc:3 NeuAc:1 (avg mass : 1729.5702 )
- Hex:5 HexNAc:3 dHex:1 (avg mass : 1584.4553 )
- Hex:5 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 1875.7132 )
- Hex:5 HexNAc:4 (avg mass : 1641.5073 )
- Hex:5 HexNAc:4 NeuAc:1 (avg mass : 1932.7652 )
- Hex:5 HexNAc:4 NeuAc:2 (avg mass : 2224.0231 )
- Hex:5 HexNAc:4 dHex:1 (avg mass : 1787.6503 )
- Hex:5 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 2078.9082 )
- Hex:5 HexNAc:4 dHex:1 NeuAc:2 (avg mass : 2370.1661 )
- Hex:5 HexNAc:4 dHex:2 NeuAc:1 (avg mass : 2225.0512 )
- Hex:5 HexNAc:4 dHex:3 (avg mass : 2079.9363 )
- Hex:5 HexNAc:4 dHex:3 NeuAc:1 (avg mass : 2371.1942 )
- Hex:5 HexNAc:5 (avg mass : 1844.7023 )
- Hex:5 HexNAc:5 NeuAc:1 (avg mass : 2135.9602 )
- Hex:5 HexNAc:5 NeuAc:2 (avg mass : 2427.2181 )
- Hex:5 HexNAc:5 dHex:1 (avg mass : 1990.8453 )
- Hex:5 HexNAc:5 dHex:1 NeuGc:1 (avg mass : 2298.1026 )
- Hex:5 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2282.1032 )
- Hex:5 HexNAc:5 dHex:2 (avg mass : 2136.9883 )
- Hex:5 HexNAc:5 dHex:2 NeuAc:1 (avg mass : 2428.2462 )
- Hex:5 HexNAc:6 NeuAc:1 (avg mass : 2339.1552 )
- Hex:5 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2485.2982 )
- Hex:6 HexNAc:2 Su:1 (avg mass : 1477.3239 )
- Hex:6 HexNAc:3 (avg mass : 1600.4547 )
- Hex:6 HexNAc:3 Su:1 (avg mass : 1680.5189 )
- Hex:6 HexNAc:3 NeuAc:1 (avg mass : 1891.7126 )
- Hex:6 HexNAc:3 NeuAc:2 (avg mass : 2182.9705 )
- Hex:6 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 2037.8556 )
- Hex:6 HexNAc:3 dHex:1 NeuAc:2 (avg mass : 2329.1135 )
- Hex:6 HexNAc:4 NeuGc:1 (avg mass : 2110.907 )
- Hex:6 HexNAc:4 NeuAc:1 (avg mass : 2094.9076 )
- Hex:6 HexNAc:4 NeuAc:2 (avg mass : 2386.1655 )
- Hex:6 HexNAc:4 dHex:1 (avg mass : 1949.7927 )
- Hex:6 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 2241.0506 )
- Hex:6 HexNAc:4 dHex:2 (avg mass : 2095.9357 )
- Hex:6 HexNAc:4 dHex:2 NeuAc:1 (avg mass : 2387.1936 )
- Hex:6 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2444.2456 )
- Hex:6 HexNAc:5 dHex:1 NeuAc:2 (avg mass : 2735.5035 )
- Hex:6 HexNAc:6 dHex:1 (avg mass : 2356.1827 )
- Hex:7 HexNAc:3 NeuAc:1 (avg mass : 2053.855 )
- Hex:7 HexNAc:4 dHex:1 (avg mass : 2111.9351 )
- Hex:7 HexNAc:6 dHex:1 (avg mass : 2518.3251 )
- Hex:7 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2809.583 )
- Hex:7 HexNAc:6 dHex:1 NeuAc:2 (avg mass : 3100.8409 )
- Hex:8 HexNAc:5 dHex:1 (avg mass : 2477.2725 )
- Hex:8 HexNAc:7 dHex:1 (avg mass : 2883.6625 )
- Hex:9 HexNAc:6 dHex:1 (avg mass : 2842.6099 )
- Hex:10 HexNAc:6 dHex:1 (avg mass : 3004.7523 )
Composition
Disease
- High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- The expression of free oligosaccharides in human seminal plasma. (2002 - Chalabi S, Easton RL, Patankar MS, Lattanzio FA, Morrison JC, Panico M, Morris HR, Dell A, Clark GF) / Status : Reviewed
- Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
- Fractionation and characterization of boar seminal plasma spermadhesion PSP-II glycoforms reveal the presence of uncommon N-acetylgalactosamine-containing N-linked oligosaccharides. (1997 - Solis D, Calvete J, Sanz L, Hettel C, Raida M, Diaz-Maurio T, Tpfer-Petersen E) / Status : Reviewed
- The structure of the O-linked carbohydrate chain of bovine seminal plasma protein PDC-109 revised by H-NMR spectroscopy A correction. (1996 - Gerwig G, Calvete J, Tpfer-Petersen E, Vliegenthart J) / Status : Reviewed
- Localization and structural characterization of an oligosaccharide O-linked to bovine PDC-109. Quantitation of the glycoprotein in seminal plasma and on the surface of ejaculated and capacitated spermatozoa. (1994 - Calvete J, Raida M, Sanz L, Wempe F, Scheit K, Romero A, Tpfer-Petersen E) / Status : Reviewed
- Primary structure of the major glycan from human seminal transferrin. (1994 - D'Andrea G, D'Alessandro A, Salucci M, Oratore A) / Status : Reviewed
- Structure of neutral oligosaccharides derived from mucus glycoproteins of human seminal plasma. (1986 - Hanisch F-G, Egge H, Peter-Katalinic J, Uhlenbruck G) / Status : Reviewed
- Primary structures and Lewis blood-group-dependent expression of major sialylated saccharides from mucus glycoproteins of human seminal plasma. (1985 - Hanisch F, Egge H, Peter-Katalini J, Uhlenbruck G, Dienst C, Fangmann R) / Status : Reviewed
- Structure of tumor-associated carbohydrate antigen Ca 19-9 on human seminal-plasma glycoproteins from healthy donors. (1984 - Hanisch F, Uhlenbruck G, Dienst C) / Status : Reviewed
Reference
-
Lactotransferrin / Homo sapiens
- Undefined site
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
-
Uncharacterized protein from Seminal Fluid / Homo sapiens
- Undefined site
-
Uncharacterized protein from Seminal Fluid / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
- Seminal plasma protein pdc-109 / Bos taurus
- Major seminal plasma glycoprotein psp-i / Sus scrofa
-
Major seminal plasma glycoprotein psp-ii / Sus scrofa
- Undefined site
- Asn-119
Reported glycosite
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- AVCGGVLVHPQWVLTAAHCIRNKSVILLGR (30aa)
- NK (2aa)
- NKSVLLGR (8aa)
Mass spectrometry observed peptide
-
- Free / Lactosamine
(avg mass : 529.4957)
- Seminal Fluid (UBERON_0006530)
-
- Free / Lactose
(avg mass : 342.3001)
- Seminal Fluid (UBERON_0006530)
-
- Free / Lactose
(avg mass : 488.4431)
- Seminal Fluid (UBERON_0006530)
-
- Free / Lactose
(avg mass : 634.5861)
- Seminal Fluid (UBERON_0006530)
-
- Free / No-core
(avg mass : 675.6387)
- Seminal Fluid (UBERON_0006530)
-
- Free / No-core
(avg mass : 691.6381)
- Seminal Fluid (UBERON_0006530)
-
- Free / No-core
(avg mass : 691.6381)
- Seminal Fluid (UBERON_0006530)
-
- Free / No-core
(avg mass : 1203.1185)
- Seminal Fluid (UBERON_0006530)
-
- Free / No-core
(avg mass : 1203.1185)
- Seminal Fluid (UBERON_0006530)
-
- Free / No-core
(avg mass : 1203.1185)
- Seminal Fluid (UBERON_0006530)
-
- Free / No-core
(avg mass : 1203.1185)
- Seminal Fluid (UBERON_0006530)
-
- Free / No-core
(avg mass : 1349.2615)
- Seminal Fluid (UBERON_0006530)
-
- Free / No-core
(avg mass : 1349.2615)
- Seminal Fluid (UBERON_0006530)
-
- Free / No-core
(avg mass : 1349.2615)
- Seminal Fluid (UBERON_0006530)
-
- Free / No-core
(avg mass : 1495.4045)
- Seminal Fluid (UBERON_0006530)
-
- N-Linked / Complex
(avg mass : 1260.1705)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1276.1699)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1317.2225)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1422.3129)
- Seminal Fluid (UBERON_0006530)
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
- N-Linked / Complex
(avg mass : 1422.3129)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1463.3655)
- Seminal Fluid (UBERON_0006530)
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
- N-Linked / Complex
(avg mass : 1463.3655)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1463.3655)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- NKSVLLGR (8aa)
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- NKSVLLGR (8aa)
-
- N-Linked / Complex
(avg mass : 1567.4278)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1567.4278)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1567.4278)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- AVCGGVLVHPQWVLTAAHCIRNKSVILLGR (30aa)
- NKSVLLGR (8aa)
-
- N-Linked / Complex
(avg mass : 1568.4559)
- Seminal Fluid (UBERON_0006530)
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
- N-Linked / Complex
(avg mass : 1584.4553)
- Seminal Fluid (UBERON_0006530)
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
- N-Linked / Complex
(avg mass : 1608.4804)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1609.5085)
- Seminal Fluid (UBERON_0006530)
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
- N-Linked / Complex
(avg mass : 1625.5079)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1625.5079)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- NKSVLLGR (8aa)
-
- N-Linked / Complex
(avg mass : 1641.5073)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1641.5073)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- NKSVLLGR (8aa)
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Seminal Fluid (UBERON_0006530)
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1682.5599)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1682.5599)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- NKSVLLGR (8aa)
-
- N-Linked / Complex
(avg mass : 1713.5708)
- Seminal Fluid (UBERON_0006530)
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
- N-Linked / Complex
(avg mass : 1713.5708)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1713.5708)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1713.5708)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- AVCGGVLVHPQWVLTAAHCIRNKSVILLGR (30aa)
- NKSVLLGR (8aa)
-
- N-Linked / Complex
(avg mass : 1754.6234)
- Seminal Fluid (UBERON_0006530)
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
- N-Linked / Complex
(avg mass : 1754.6234)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1754.6234)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- AVCGGVLVHPQWVLTAAHCIRNKSVILLGR (30aa)
- NKSVLLGR (8aa)
-
- N-Linked / Complex
(avg mass : 1770.6228)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1770.6228)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- NKSVLLGR (8aa)
-
- N-Linked / Complex
(avg mass : 1787.6503)
- Seminal Fluid (UBERON_0006530)
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
- N-Linked / Complex
(avg mass : 1787.6503)
- Seminal Fluid (UBERON_0006530)
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
- N-Linked / Complex
(avg mass : 1787.6503)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1787.6503)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- AVCGGVLVHPQWVLTAAHCIRNKSVILLGR (30aa)
- NKSVLLGR (8aa)
-
- N-Linked / Complex
(avg mass : 1811.6754)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1828.7029)
- Seminal Fluid (UBERON_0006530)
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
- N-Linked / Complex
(avg mass : 1828.7029)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1828.7029)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- NKSVLLGR (8aa)
-
- N-Linked / Complex
(avg mass : 1869.7555)
- Seminal Fluid (UBERON_0006530)
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
- N-Linked / Complex
(avg mass : 1908.7671)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- NKSVLLGR (8aa)
-
- N-Linked / Complex
(avg mass : 1916.7658)
- Seminal Fluid (UBERON_0006530)
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
- N-Linked / Complex
(avg mass : 1916.7658)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1916.7658)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- AVCGGVLVHPQWVLTAAHCIRNKSVILLGR (30aa)
- NKSVLLGR (8aa)
-
- N-Linked / Complex
(avg mass : 1932.7652)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1932.7652)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- AVCGGVLVHPQWVLTAAHCIRNKSVILLGR (30aa)
- NKSVLLGR (8aa)
-
- N-Linked / Complex
(avg mass : 1949.7927)
- Seminal Fluid (UBERON_0006530)
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
- N-Linked / Complex
(avg mass : 1957.8184)
- Seminal Fluid (UBERON_0006530)
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
- N-Linked / Complex
(avg mass : 1957.8184)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1957.8184)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- NKSVLLGR (8aa)
-
- N-Linked / Complex
(avg mass : 1973.8178)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1973.8178)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- NKSVLLGR (8aa)
-
- N-Linked / Complex
(avg mass : 1990.8453)
- Seminal Fluid (UBERON_0006530)
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
- N-Linked / Complex
(avg mass : 2014.8704)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 2014.8704)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- AVCGGVLVHPQWVLTAAHCIRNKSVILLGR (30aa)
- NKSVLLGR (8aa)
-
- N-Linked / Complex
(avg mass : 2078.9082)
- Seminal Fluid (UBERON_0006530)
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
- N-Linked / Complex
(avg mass : 2078.9082)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 2078.9082)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 2078.9082)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- AVCGGVLVHPQWVLTAAHCIRNKSVILLGR (30aa)
- NKSVLLGR (8aa)
-
- N-Linked / Complex
(avg mass : 2095.9357)
- Seminal Fluid (UBERON_0006530)
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
- N-Linked / Complex
(avg mass : 2111.9351)
- Seminal Fluid (UBERON_0006530)
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
- N-Linked / Complex
(avg mass : 2119.9608)
- Seminal Fluid (UBERON_0006530)
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
- N-Linked / Complex
(avg mass : 2119.9608)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 2119.9608)
- Seminal Fluid (UBERON_0006530)
Source
- N-Linked / Complex
(avg mass : 2119.9608)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2119.9608)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2119.9608)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2111.9351)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2095.9357)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2078.9082)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2078.9082)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2078.9082)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2078.9082)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2014.8704)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2014.8704)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1990.8453)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1973.8178)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1973.8178)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1957.8184)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1957.8184)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1957.8184)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1949.7927)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1932.7652)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1932.7652)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1908.7671)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1869.7555)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1828.7029)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1828.7029)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1828.7029)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1811.6754)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1787.6503)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1787.6503)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1787.6503)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1787.6503)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1770.6228)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1770.6228)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1754.6234)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1754.6234)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1754.6234)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1713.5708)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1713.5708)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1713.5708)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1713.5708)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1682.5599)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1682.5599)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1641.5073)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1641.5073)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1625.5079)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1625.5079)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1609.5085)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1608.4804)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1584.4553)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1568.4559)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1567.4278)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1567.4278)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1567.4278)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1479.3649)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1479.3649)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1463.3655)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1463.3655)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1463.3655)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1422.3129)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1422.3129)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1317.2225)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1276.1699)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1260.1705)
Source
Reported glycosite
- Free / No-core
(avg mass : 1495.4045)
Source
Reported glycosite
- Free / No-core
(avg mass : 1349.2615)
Source
Reported glycosite
- Free / No-core
(avg mass : 1349.2615)
Source
Reported glycosite
- Free / No-core
(avg mass : 1349.2615)
Source
Reported glycosite
- Free / No-core
(avg mass : 1203.1185)
Source
Reported glycosite
- Free / No-core
(avg mass : 1203.1185)
Source
Reported glycosite
- Free / No-core
(avg mass : 1203.1185)
Source
Reported glycosite
- Free / No-core
(avg mass : 1203.1185)
Source
Reported glycosite
- Free / No-core
(avg mass : 691.6381)
Source
Reported glycosite
- Free / No-core
(avg mass : 691.6381)
Source
Reported glycosite
- Free / No-core
(avg mass : 675.6387)
Source
Reported glycosite
- Free / Lactose
(avg mass : 634.5861)
Source
Reported glycosite
- Free / Lactose
(avg mass : 488.4431)
Source
Reported glycosite
- Free / Lactose
(avg mass : 342.3001)
Source
Reported glycosite
- Free / Lactosamine
(avg mass : 529.4957)