taxonomy (22)
protein (118)
source (2)
structure (579)
composition (251)
disease (0)
reference (46)
site (214)
peptide (233)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Bubalus arnee bubalis (Water buffalo)
- Canis lupus familiaris (Dog)
- Diceros bicornis (Black rhinoceros)
- Giraffa camelopardalis (Giraffe)
- Gorilla gorilla (Gorilla)
- Macropus eugenii (Tammar wallaby)
- Macropus giganteus (Eastern gray kangaroo)
- Macropus rufus (Red kangaroo)
- Nasua narica (White-nosed coati)
- Pan paniscus (Pygmy chimpanzee [bonobo])
- Pan troglodytes (Chimpanzee)
- Pongo pygmaeus (Orangutan)
- Tachyglossus aculeatus (Australian echidna)
- Trichechus manatus (Carribean/florida manatee)
- Tursiops truncatus (Bottle-nose dolphin)
- Ursus americanus (Black bear)
- Ursus arctos (Grizzly bear)
- Ursus arctos yesoensis (Eezo brown bear)
- Ursus maritimus (Polar bear)
- Ursus thibetanus japonicus (Japanese black bear)
Taxonomy
- ADAM DEC1 / Homo sapiens O15204
- Afamin / Homo sapiens P43652
- Alpha-1-acid glycoprotein 1 / Homo sapiens P02763
- Alpha-1-acid glycoprotein 2 / Homo sapiens P19652
- Alpha-1-antichymotrypsin / Homo sapiens P01011
- Alpha-1-antitrypsin / Homo sapiens P01009
- Alpha-1b-glycoprotein / Homo sapiens P04217
- Alpha-2-HS-glycoprotein / Homo sapiens P02765
- Alpha-L-iduronidase / Homo sapiens P35475
- Alpha-S1-casein / Homo sapiens P47710
- Angiopoietin-related protein 4 / Homo sapiens Q9BY76
- Angiotensin-converting enzyme / Homo sapiens P12821
- Angiotensinogen / Homo sapiens P01019
- Antithrombin-III / Homo sapiens P01008
- Apolipoprotein B-100 / Homo sapiens P04114
- Apolipoprotein D / Homo sapiens P05090
- Attractin / Homo sapiens O75882
- Beta-2-glycoprotein 1 / Homo sapiens P02749
- Bile-salt-activated lipase / Homo sapiens P19835
- Biotinidase / Homo sapiens P43251
- Butyrophilin subfamily 1 member A1 / Homo sapiens Q13410
- Carbonic anhydrase 6 / Homo sapiens P23280
- Cathepsin B / Homo sapiens P07858
- CD59 glycoprotein / Homo sapiens P13987
- CD63 antigen / Homo sapiens P08962
- Ceroid-lipofuscinosis neuronal protein 5 / Homo sapiens O75503
- Ceruloplasmin / Homo sapiens P00450
- Chordin-like protein 2 / Homo sapiens Q6WN34
- Clusterin / Homo sapiens P10909
- Complement C1r subcomponent-like protein / Homo sapiens Q9NZP8
- Complement c3 / Homo sapiens P01024
- Complement c4-a / Homo sapiens P0C0L4
- Complement C4-B / Homo sapiens P0C0L5
- Complement factor b / Homo sapiens P00751
- Complement factor h / Homo sapiens P08603
- Complement factor i / Homo sapiens P05156
- Desmocollin-2 / Homo sapiens Q02487
- Dipeptidyl peptidase 1 / Homo sapiens P53634
- Ectonucleoside triphosphate diphosphohydrolase 3 / Homo sapiens O75355
- Endoplasmin / Homo sapiens P14625
- Ephrin-A1 / Homo sapiens P20827
- Extracellular sulfatase Sulf-2 / Homo sapiens Q8IWU5
- Fibrinogen beta chain / Homo sapiens P02675
- Fibrinogen gamma chain / Homo sapiens P02679
- Fibronectin / Homo sapiens P02751
- Folate receptor alpha / Homo sapiens P15328
- Galectin-3-binding protein / Homo sapiens Q08380
- Gamma-glutamyltranspeptidase 1 / Homo sapiens P19440
- Glucosylceramidase / Homo sapiens P04062
- Haptoglobin / Homo sapiens P00738
- Hemopexin / Homo sapiens P02790
- Heparin cofactor 2 / Homo sapiens P05546
- HLA class II histocompatibility antigen gamma chain / Homo sapiens P04233
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant gamma 1 / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Immunoglobulin J chain / Homo sapiens P01591
- Kallikrein-6 / Homo sapiens Q92876
- Kappa casein / Homo sapiens P07498
- Kinesin-1 heavy chain / Homo sapiens P33176
- Kininogen-1 / Homo sapiens P01042
- Lactadherin / Homo sapiens Q08431
- Lactoperoxidase / Homo sapiens P22079
- Lactotransferrin / Homo sapiens P02788
- Legumain / Homo sapiens Q99538
- Leucine-rich alpha-2-glycoprotein / Homo sapiens P02750
- Lipoprotein lipase / Homo sapiens P06858
- Lumican / Homo sapiens P51884
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Macrophage mannose receptor 1 / Homo sapiens P22897
- Metalloproteinase inhibitor 1 / Homo sapiens P01033
- Monocyte differentiation antigen cd14 / Homo sapiens P08571
- Myeloperoxidase / Homo sapiens P05164
- Myoferlin / Homo sapiens Q9NZM1
- N-acetylglucosamine-1-phosphotransferase subunit gamma / Homo sapiens Q9UJJ9
- Natural cytotoxicity triggering receptor 3 ligand 1 / Homo sapiens Q68D85
- Neuroblastoma suppressor of tumorigenicity 1 / Homo sapiens P41271
- Neuropilin-1 / Homo sapiens O14786
- Neutrophil gelatinase-associated lipocalin / Homo sapiens P80188
- Nucleotide exchange factor SIL1 / Homo sapiens Q9H173
- Olfactomedin-4 / Homo sapiens Q6UX06
- Palmitoyl-protein thioesterase 1 / Homo sapiens P50897
- Peptidyl-prolyl cis-trans isomerase B / Homo sapiens P23284
- Peptidyl-prolyl cis-trans isomerase C / Homo sapiens P45877
- Phospholipid transfer protein / Homo sapiens P55058
- Plasma protease c1 inhibitor / Homo sapiens P05155
- Platelet glycoprotein 4 / Homo sapiens P16671
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Pro-epidermal growth factor / Homo sapiens P01133
- Prosaposin / Homo sapiens P07602
- Prothrombin / Homo sapiens P00734
- Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens Q15262
- Recombinant Mucin-1 Muc1f/4tr / Homo sapiens P15941 Q99102
- Sclerostin domain-containing protein 1 / Homo sapiens Q6X4U4
- Selenoprotein P / Homo sapiens P49908
- Serotransferrin / Homo sapiens P02787
- Serum paraoxonase/arylesterase 1 / Homo sapiens P27169
- Sortilin / Homo sapiens Q99523
- Sparc-like protein 1 / Homo sapiens Q14515
- Sulfhydryl oxidase 1 / Homo sapiens O00391
- Tenascin / Homo sapiens P24821
- Thrombospondin-1 / Homo sapiens P07996
- Tissue alpha-L-fucosidase / Homo sapiens P04066
- Toll-like receptor 2 / Homo sapiens O60603
- Trans-Golgi network integral membrane protein 2 / Homo sapiens O43493
- Transcobalamin-1 / Homo sapiens P20061
- Tumor necrosis factor ligand superfamily member 13 / Homo sapiens O75888
- Tumor necrosis factor receptor superfamily member 11B / Homo sapiens O00300
- Unspecified mucin / Homo sapiens
- Vitronectin / Homo sapiens P04004
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Casein / Bos taurus
- Kappa casein / Bos taurus P02668
- Lactophorin / Bos taurus P80195
- Lactotransferrin / Bos taurus P24627
- Uncharacterized protein from Milk / Bos taurus
Protein
- Free / Lactosamine / Structure 9034
- Free / Lactosamine / Structure 9035
- Free / Lactosamine / Structure 9029
- Free / Lactosamine / Structure 9030
- Free / Lactosamine / NeuAc(a2-3)Gal(b1-3)[Fuc(a1-4)]GlcNAc
- Free / Lactose / Gal(b1-4)Glc
- Free / Lactose / HSO3(-3)Gal(b1-4)Glc
- Free / Lactose / Fuc(a1-2)Gal(b1-4)Glc
- Free / Lactose / Fuc(a1-3)[Gal(b1-4)]Glc
- Free / Lactose / Gal(a1-3)Gal(b1-4)Glc
- Free / Lactose / Gal(b1-3)Gal(b1-4)Glc
- Free / Lactose / Structure 10838
- Free / Lactose / Structure 10840
- Free / Lactose / Structure 10841
- Free / Lactose / GlcNAc(b1-3)Gal(b1-4)Glc(b1-
- Free / Lactose / NeuAc(a2-3)Gal(b1-4)Glc
- Free / Lactose / NeuAc(a2-6)Gal(b1-4)Glc
- Free / Lactose / Fuc(a1-2)Gal(b1-4)[Fuc(a1-3)]Glc
- Free / Lactose / Fuc(a1-2)[Gal(a1-3)]Gal(b1-4)Glc
- Free / Lactose / Gal(a1-3)Gal(b1-4)[Fuc(a1-3)]Glc
- Free / Lactose / Neu4,5Ac2(a2-3)Gal(b1-4)Glc
- Free / Lactose / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)Glc
- Free / Lactose / Gal(b1-3)[GlcNAc(b1-6)]Gal(b1-4)Glc
- Free / Lactose / Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)Glc
- Free / Lactose / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)Glc
- Free / Lactose / Neu5Ac(a2-3)[6S]Gal(b1-4)Glc(b1-
- Free / Lactose / NeuAc(a2-3)Gal(b1-4)[Fuc(a1-3)]Glc
- Free / Lactose / Fuc(a1-2)[Gal(a1-3)]Gal(b1-4)[Fuc(a1-3)]Glc
- Free / Lactose / Structure 9214
- Free / Lactose / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)[Fuc(a1-3)]Glc
- Free / Lactose / Fuc(a1-3)[Fuc(a1-4)GlcNAc(b1-3)Gal(b1-4)]Glc
- Free / Lactose / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)Glc
- Free / Lactose / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)Glc
- Free / Lactose / Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)Gal(b1-4)Glc(b1-
- Free / Lactose / Gal(b1-?)[Fuc(a1-?)]GlcNAc(b1-3)Gal(b1-4)Glc
- Free / Lactose / Structure 8957
- Free / Lactose / Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)Glc(b1-
- Free / Lactose / Structure 8965
- Free / Lactose / Structure 9057
- Free / Lactose / Structure 10837
- Free / Lactose / Gal(a1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)Glc
- Free / Lactose / Gal(b1-3)[Gal(b1-4)]GlcNAc(b1-3)Gal(b1-4)Glc(b1-
- Free / Lactose / Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]Gal(b1-4)Glc
- Free / Lactose / GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)Glc
- Free / Lactose / Structure 9158
- Free / Lactose / Structure 9219
- Free / Lactose / Gal(b1-3)[Neu5Ac(a2-6)]GlcNAc(b1-3)Gal(b1-4)Glc(b1-
- Free / Lactose / Gal(b1-3)[NeuAc(a2-6)]GlcNAc(b1-3)Gal(b1-4)Glc
- Free / Lactose / NeuAc(a2-3)Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)Glc
- Free / Lactose / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)Glc
- Free / Lactose / [Fuc(a1-2)]Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)Gal(b1-4)Glc(b1-
- Free / Lactose / Fuc(a1-2)Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)Gal(b1-4)Glc
- Free / Lactose / Fuc(a1-2)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)Glc
- Free / Lactose / Fuc(a1-4)[Gal(b1-3)]GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]Glc
- Free / Lactose / Structure 8959
- Free / Lactose / Structure 8991
- Free / Lactose / Fuc(a1-2)[Gal(a1-3)]Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)Glc
- Free / Lactose / Gal(a1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)Glc
- Free / Lactose / Structure 9155
- Free / Lactose / Gal(b1-3)Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-4)Glc
- Free / Lactose / [Gal(b1-4)GlcNAc(b1-6)][Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)Glc(b1-
- Free / Lactose / Gal(b1-4)GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-4)Glc
- Free / Lactose / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)Glc(b1-
- Free / Lactose / [Fuc(a1-2)]Gal(b1-3)[Neu5Ac(a2-6)]GlcNAc(b1-3)Gal(b1-4)Glc(b1-
- Free / Lactose / Neu5Ac(a2-3)Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)Gal(b1-4)Glc(b1-
- Free / Lactose / Structure 8967
- Free / Lactose / Neu5Ac(a2-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)Glc(b1-
- Free / Lactose / Neu5Ac(a2-6)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)Glc(b1-
- Free / Lactose / Structure 9215
- Free / Lactose / Fuc(a1-2)[Gal(a1-3)]Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)Glc
- Free / Lactose / Gal(a1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]Glc
- Free / Lactose / GalNAc(a1-3)[Fuc(a1-2)]Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)Gal(b1-4)Glc(b1-
- Free / Lactose / [[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-6)][Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [[Fuc(a1-3)]Gal(b1-4)GlcNAc(b1-6)][Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Fuc(a1-2)]Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)Glc(b1-
- Free / Lactose / [Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)GlcNAc(b1-6)][Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)GlcNAc(b1-6)][Gal(b1-4)[Fuc(a1-2)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)GlcNAc(b1-6)][Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Gal(b1-4)Glc
- Free / Lactose / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-6)[Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)Glc
- Free / Lactose / Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)Glc(b1-
- Free / Lactose / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)Glc(b1-
- Free / Lactose / Structure 9217
- Free / Lactose / Structure 10114
- Free / Lactose / Structure 10842
- Free / Lactose / Structure 10843
- Free / Lactose / Gal(a1-3)Gal(b1-4)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Gal(b1-4)Glc
- Free / Lactose / Structure 9218
- Free / Lactose / Neu5Ac(a2-3)Gal(b1-3)[Neu5Ac(a2-6)]GlcNAc(b1-3)Gal(b1-4)Glc(b1-
- Free / Lactose / NeuAc(a2-3)Gal(b1-3)[NeuAc(a2-6)]GlcNAc(b1-3)Gal(b1-4)Glc
- Free / Lactose / Structure 10879
- Free / Lactose / Structure 9216
- Free / Lactose / [Gal(b1-4)GlcNAc(b1-6)][Gal(b1-3)[Neu5Ac(a2-6)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)GlcNAc(b1-6)][Neu5Ac(a2-6)Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)GlcNAc(b1-6)][Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-6)][Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-6)][Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)[Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-6)]Gal(b1-4)Glc
- Free / Lactose / Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)Glc(b1-
- Free / Lactose / Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)Glc(b1-
- Free / Lactose / Structure 10844
- Free / Lactose / Structure 10845
- Free / Lactose / Structure 10880
- Free / Lactose / Structure 10881
- Free / Lactose / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-?)[Gal(a1-3)Gal(b1-4)GlcNAc(b1-?)]Gal(b1-4)Glc
- Free / Lactose / Structure 9152
- Free / Lactose / Structure 9220
- Free / Lactose / Structure 9221
- Free / Lactose / Gal(a1-3)Gal(b1-4)GlcNAc(b1-3)[Gal(a1-3)Gal(b1-4)GlcNAc(b1-6)]Gal(b1-4)Glc
- Free / Lactose / Structure 9222
- Free / Lactose / Neu5Ac(a2-3)Gal(b1-3)[Neu5Ac(a2-6)][Fuc(a1-4)]GlcNAc(b1-3)Gal(b1-4)Glc(b1-
- Free / Lactose / Structure 8923
- Free / Lactose / [Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / Structure 9199
- Free / Lactose / Structure 9207
- Free / Lactose / [[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-6)][Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][Gal(b1-3)[Neu5Ac(a2-6)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][Neu5Ac(a2-3)Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-3)[Neu5Ac(a2-6)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)GlcNAc(b1-6)][Neu5Ac(a2-3)Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-6)][Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / Neu5Ac(a2-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)Glc(b1-
- Free / Lactose / Neu5Ac(a2-6)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)Glc(b1-
- Free / Lactose / Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)Glc(b1-
- Free / Lactose / NeuAc(a2-3)Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-4)Glc
- Free / Lactose / Structure 10871
- Free / Lactose / Structure 8929
- Free / Lactose / [[Fuc(a1-2)]Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / Structure 10846
- Free / Lactose / Structure 10847
- Free / Lactose / Structure 10882
- Free / Lactose / Structure 9154
- Free / Lactose / Structure 9157
- Free / Lactose / [Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / Structure 9212
- Free / Lactose / Structure 10113
- Free / Lactose / Structure 10115
- Free / Lactose / Structure 10848
- Free / Lactose / Structure 10849
- Free / Lactose / Structure 10850
- Free / Lactose / [Gal(b1-4)GlcNAc(b1-6)][Neu5Ac(a2-3)Gal(b1-3)[Neu5Ac(a2-6)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-6)][Neu5Ac(a2-3)Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-6)][Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [[Fuc(a1-2)]Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][Neu5Ac(a2-3)Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-3)][[Fuc(a1-2)]Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / NeuAc(a2-3)Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)[Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-6)]Gal(b1-4)Glc
- Free / Lactose / Structure 10872
- Free / Lactose / Structure 10873
- Free / Lactose / Fuc(a1-2)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)[Fuc(a1-2)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)]Gal(b1-4)Glc
- Free / Lactose / Structure 9208
- Free / Lactose / Structure 9156
- Free / Lactose / Gal(a1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)[Gal(a1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)]Gal(b1-4)Glc
- Free / Lactose / [Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [[Fuc(a1-2)]Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [[Fuc(a1-2)]Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / Structure 9197
- Free / Lactose / Structure 9200
- Free / Lactose / Structure 9201
- Free / Lactose / Structure 9202
- Free / Lactose / Structure 9223
- Free / Lactose / Structure 10839
- Free / Lactose / Structure 10851
- Free / Lactose / Structure 10852
- Free / Lactose / Structure 10853
- Free / Lactose / Structure 10854
- Free / Lactose / Structure 10855
- Free / Lactose / Structure 9153
- Free / Lactose / [[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-6)][Neu5Ac(a2-3)Gal(b1-3)[Neu5Ac(a2-6)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][Neu5Ac(a2-3)Gal(b1-3)[Neu5Ac(a2-6)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Neu5Ac(a2-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][Neu5Ac(a2-6)Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-6)][Neu5Ac(a2-3)Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-6)][Neu5Ac(a2-6)[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / NeuAc(a2-3)Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-6)]Gal(b1-4)Glc
- Free / Lactose / Structure 10117
- Free / Lactose / Structure 10118
- Free / Lactose / Structure 10119
- Free / Lactose / Structure 10120
- Free / Lactose / Structure 10121
- Free / Lactose / [[Gal(b1-4)GlcNAc(b1-6)][Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)GlcNAc(b1-6)][Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / Structure 9210
- Free / Lactose / Fuc(a1-2)[Gal(a1-3)]Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)[Gal(a1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)]Gal(b1-4)Glc
- Free / Lactose / Fuc(a1-2)[Gal(a1-3)]Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)[Gal(a1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)]Gal(b1-4)Glc
- Free / Lactose / [[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)]Gal(b1-4)Glc
- Free / Lactose / Structure 9198
- Free / Lactose / Structure 9204
- Free / Lactose / Structure 9205
- Free / Lactose / [[Fuc(a1-2)]Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [[Fuc(a1-2)]Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [[Fuc(a1-2)]Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / Structure 10116
- Free / Lactose / Structure 10856
- Free / Lactose / Structure 10857
- Free / Lactose / Structure 10858
- Free / Lactose / [GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-6)][Neu5Ac(a2-3)Gal(b1-3)[Neu5Ac(a2-6)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / Structure 9159
- Free / Lactose / Structure 9160
- Free / Lactose / Structure 9206
- Free / Lactose / Structure 10860
- Free / Lactose / Structure 10867
- Free / Lactose / [[Fuc(a1-2)]Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)]Gal(b1-4)Glc
- Free / Lactose / Fuc(a1-4)[Gal(b1-3)]GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)]Gal(b1-4)Glc
- Free / Lactose / Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)]Gal(b1-4)Glc
- Free / Lactose / Structure 10874
- Free / Lactose / Structure 10875
- Free / Lactose / Structure 10876
- Free / Lactose / [[Fuc(a1-2)]Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [[Fuc(a1-2)]Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [[Fuc(a1-2)]Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / Structure 9209
- Free / Lactose / [[Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-6)][Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)GlcNAc(b1-6)][Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [[Fuc(a1-2)]Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [[Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / Structure 9161
- Free / Lactose / Structure 9162
- Free / Lactose / Structure 9166
- Free / Lactose / Structure 9167
- Free / Lactose / Structure 10861
- Free / Lactose / Structure 10862
- Free / Lactose / Structure 10863
- Free / Lactose / Structure 10864
- Free / Lactose / Structure 10868
- Free / Lactose / Structure 10869
- Free / Lactose / Structure 10870
- Free / Lactose / [Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][Neu5Ac(a2-3)Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][Neu5Ac(a2-6)[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [[Fuc(a1-2)]Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / Structure 10877
- Free / Lactose / [[Fuc(a1-2)]Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / Structure 10859
- Free / Lactose / [[Fuc(a1-2)]Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [[Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)GlcNAc(b1-6)][Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Neu5Ac(a2-6)Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / Structure 9196
- Free / Lactose / [[[Fuc(a1-2)]Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [[Gal(b1-4)GlcNAc(b1-6)][Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)]Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [[Gal(b1-4)GlcNAc(b1-6)][Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / Structure 9168
- Free / Lactose / Structure 9169
- Free / Lactose / Structure 9170
- Free / Lactose / Structure 9171
- Free / Lactose / Structure 9173
- Free / Lactose / Structure 10865
- Free / Lactose / Structure 9176
- Free / Lactose / Structure 9177
- Free / Lactose / Structure 9178
- Free / Lactose / [[Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)]Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / Structure 9174
- Free / Lactose / Structure 9175
- Free / Lactose / Structure 10866
- Free / Lactose / [[Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / Structure 9179
- Free / Lactose / Structure 9180
- Free / Lactose / Structure 9181
- Free / Lactose / Structure 9182
- Free / Lactose / [[Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)GlcNAc(b1-6)][Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / [[[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / Structure 9183
- Free / Lactose / Structure 9184
- Free / Lactose / Structure 9185
- Free / Lactose / Structure 9186
- Free / Lactose / Structure 9187
- Free / Lactose / Structure 9188
- Free / Lactose / [[[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)][[Fuc(a1-2)]Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)GlcNAc(b1-6)][Neu5Ac(a2-6)Gal(b1-4)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / Structure 9189
- Free / Lactose / Structure 9190
- Free / Lactose / Structure 9191
- Free / Lactose / Structure 9192
- Free / Lactose / Structure 9193
- Free / Lactose / Structure 9194
- Free / Lactose / Structure 9195
- Free / No-core / Fuc(a1-2)Gal(b1-3)[NeuAc(a2-6)]GlcNAc(b1-3)Gal(b1-3)Glc
- Free / Truncated / Structure 9036
- Free / Truncated / NeuAc(a2-3)Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)Gal
- N-Linked / Complex / Structure 2843
- N-Linked / Complex / Structure 1850
- N-Linked / Complex / Structure 1994
- N-Linked / Complex / Structure 9533
- N-Linked / Complex / Structure 348
- N-Linked / Complex / Structure 9409
- N-Linked / Complex / Structure 1497
- N-Linked / Complex / Structure 2643
- N-Linked / Complex / Structure 9500
- N-Linked / Complex / Structure 9446
- N-Linked / Complex / Structure 9527
- N-Linked / Complex / Structure 9501
- N-Linked / Complex / Structure 2719
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-?)GlcNAc(?1-?)Man(a1-3)[Gal(b1-4)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 9460
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 9418
- N-Linked / Complex / GlcNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 9423
- N-Linked / Complex / Structure 9417
- N-Linked / Complex / Structure 9431
- N-Linked / Complex / Structure 9523
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9520
- N-Linked / Complex / Structure 9474
- N-Linked / Complex / GlcNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9545
- N-Linked / Complex / Structure 9469
- N-Linked / Complex / Structure 9389
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 1344
- N-Linked / Complex / Structure 3507
- N-Linked / Complex / Structure 32
- N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9507
- N-Linked / Complex / Structure 9430
- N-Linked / Complex / Structure 9481
- N-Linked / Complex / Structure 9453
- N-Linked / Complex / Structure 9457
- N-Linked / Complex / Structure 9544
- N-Linked / Complex / Structure 2014
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Gal(b1-4) + GalNAc(b1-4)"
- N-Linked / Complex / Structure 1854
- N-Linked / Complex / Structure 9455
- N-Linked / Complex / Structure 9433
- N-Linked / Complex / Fuc(a1-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 1523
- N-Linked / Complex / Structure 9390
- N-Linked / Complex / Structure 9411
- N-Linked / Complex / Gal(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 9511
- N-Linked / Complex / Structure 9541
- N-Linked / Complex / Structure 1945
- N-Linked / Complex / Structure 9374
- N-Linked / Complex / Structure 9540
- N-Linked / Complex / Structure 9385
- N-Linked / Complex / Structure 9502
- N-Linked / Complex / Structure 9452
- N-Linked / Complex / Structure 9537
- N-Linked / Complex / Structure 9525
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x Gal(b1-4) + GalNAc(b1-4)"
- N-Linked / Complex / Structure 9463
- N-Linked / Complex / NeuAc(?2-?)Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[NeuAc(?2-?)Gal(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Fuc(a1-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9425
- N-Linked / Complex / Structure 9486
- N-Linked / Complex / Structure 9394
- N-Linked / Complex / Gal(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9368
- N-Linked / Complex / Structure 9485
- N-Linked / Complex / Structure 9464
- N-Linked / Complex / Structure 9487
- N-Linked / Complex / Structure 9454
- N-Linked / Complex / Structure 9473
- N-Linked / Complex / Structure 9470
- N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9508
- N-Linked / Complex / Structure 9484
- N-Linked / Complex / Structure 9477
- N-Linked / Complex / Structure 9412
- N-Linked / Complex / Neu?c(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Neu?c(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 1519
- N-Linked / Complex / Structure 9372
- N-Linked / Complex / Structure 9498
- N-Linked / Complex / Structure 9386
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-?)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x Gal(b1-4) + GalNAc(b1-4)"
- N-Linked / Complex / Structure 9466
- N-Linked / Complex / Structure 9499
- N-Linked / Complex / Structure 9512
- N-Linked / Complex / Structure 9378
- N-Linked / Complex / Structure 9509
- N-Linked / Complex / Structure 9529
- N-Linked / Complex / Structure 9375
- N-Linked / Complex / Structure 9373
- N-Linked / Complex / Structure 9407
- N-Linked / Complex / Structure 9443
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Fuc(a1-6)[Gal(b1-4)]GlcNAc(?1-2)Man(?1-6)]Man(?1-4)[Fuc(a1-3)Fuc(a1-3)]GlcNAc+"+ NeuAc(?2-6)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-?)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 3 x Gal(b1-4) + GalNAc(b1-4)"
- N-Linked / Complex / Structure 9542
- N-Linked / Complex / Structure 9408
- N-Linked / Complex / Structure 9462
- N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9490
- N-Linked / Complex / Structure 9524
- N-Linked / Complex / Structure 9461
- N-Linked / Complex / Structure 9532
- N-Linked / Complex / Structure 9496
- N-Linked / Complex / Structure 9494
- N-Linked / Complex / Structure 9483
- N-Linked / Complex / Structure 9401
- N-Linked / Complex / Structure 9451
- N-Linked / Complex / Structure 9414
- N-Linked / Complex / Structure 9427
- N-Linked / Complex / Structure 9517
- N-Linked / Complex / Structure 9478
- N-Linked / Complex / Structure 9482
- N-Linked / Complex / Structure 3222
- N-Linked / Complex / Structure 9441
- N-Linked / Complex / Structure 9465
- N-Linked / Complex / Structure 9495
- N-Linked / Complex / Structure 9480
- N-Linked / Complex / Structure 9444
- N-Linked / Complex / Structure 9514
- N-Linked / Complex / Structure 9421
- N-Linked / Complex / Structure 9522
- N-Linked / Complex / Structure 9392
- N-Linked / Complex / Structure 9388
- N-Linked / Complex / Structure 9429
- N-Linked / Complex / Structure 2404
- N-Linked / Complex / Structure 9472
- N-Linked / Complex / Structure 9513
- N-Linked / Complex / Structure 9377
- N-Linked / Complex / Structure 3656
- N-Linked / Complex / Structure 9376
- N-Linked / Complex / Structure 9521
- N-Linked / Complex / Structure 775
- N-Linked / Complex / Structure 9367
- N-Linked / Complex / Structure 788
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Structure 314
- N-Linked / High-Mannose / Structure 2636
- N-Linked / High-Mannose / Structure 9447
- N-Linked / High-Mannose / Structure 9534
- N-Linked / High-Mannose / Structure 9516
- N-Linked / Hybrid / Structure 9536
- N-Linked / Hybrid / Structure 9371
- N-Linked / Hybrid / Structure 1713
- N-Linked / Hybrid / Structure 9492
- N-Linked / Hybrid / Structure 9488
- N-Linked / Hybrid / Structure 9535
- N-Linked / Hybrid / Structure 9493
- N-Linked / Hybrid / Structure 9403
- N-Linked / Hybrid / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-2)Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 9459
- N-Linked / Hybrid / Structure 9476
- N-Linked / Hybrid / Structure 3266
- N-Linked / Hybrid / Structure 9426
- N-Linked / Hybrid / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-2)Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Hybrid / Structure 9505
- N-Linked / Hybrid / Structure 9526
- N-Linked / Hybrid / Structure 9381
- N-Linked / Hybrid / Structure 9419
- N-Linked / Hybrid / Structure 9399
- N-Linked / Hybrid / Structure 9506
- N-Linked / Hybrid / Structure 9489
- N-Linked / Hybrid / Structure 9415
- N-Linked / Hybrid / Structure 9440
- N-Linked / Hybrid / Structure 9475
- N-Linked / Hybrid / Structure 9442
- N-Linked / Hybrid / Structure 9437
- N-Linked / Hybrid / Structure 9396
- N-Linked / Hybrid / Structure 9531
- N-Linked / Hybrid / Structure 9510
- N-Linked / Hybrid / Structure 9439
- N-Linked / Hybrid / Structure 9402
- N-Linked / Hybrid / Structure 9428
- N-Linked / No-core / GlcNAc(b1-4)GlcNAc
- N-Linked / No-core / Fuc(a1-6)[GlcNAc(b1-4)]GlcNAc
- N-Linked / No-core / Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / No-core / Man(a1-6)Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / No-core / Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Pauci-Mannose / Structure 1786
- N-Linked / Pauci-Mannose / Structure 9449
- N-Linked / Truncated / Structure 9398
- N-Linked / Undefined core / Fuc(a1-3)[Gal(b1-?)]GlcNAc(?1-?)Man(a1-?)[Fuc(a1-3)[Gal(b1-?)]GlcNAc(?1-?)Gal(?1-?)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- O-Linked / Core 0 / GalNAc
- O-Linked / Core 1 / Structure 685
- O-Linked / Core 1 / Gal(b1-3)GalNAc
- O-Linked / Core 1 / Gal(?1-?)GalNAc + "Neu5Ac"
- O-Linked / Core 1 / Gal(b1-3)[NeuAc(a2-6)]GalNAc
- O-Linked / Core 1 / NeuAc(a2-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / NeuAc(?2-?)Gal(?1-?)[NeuAc(?2-?)]GalNAc
- O-Linked / Core 1 / NeuAc(a2-3)Gal(b1-3)[NeuAc(a2-6)]GalNAc
- O-Linked / Core 2 / Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Structure 639
- O-Linked / Core 2 / NeuAc(a2-3)Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-4)GlcNAc(b1-6)[GlcNAc(b1-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-4)GlcNAc(b1-6)[GlcNAc(b1-6)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-6)[GlcNAc(b1-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-6)[GlcNAc(b1-6)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(?1-?)GlcNAc(?1-?)[Neu5Ac(?2-?)Gal(?1-?)]GalNAc(?1-
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-4)GlcNAc(b1-3)Gal(b1-3)[Fuc(a1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-4)GlcNAc(b1-6)Gal(b1-3)[Fuc(a1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-4)GlcNAc(b1-3)Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-4)GlcNAc(b1-6)Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Gal(b1-3)GlcNAc(b1-3)Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Neu5Ac(?2-?)Gal(?1-?)GlcNAc(?1-?)[Neu5Ac(?2-?)Gal(?1-?)]GalNAc(?1-
- O-Linked / Core 2 / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-3)GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-?)[Gal(b1-?)]GlcNAc(b1-?)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-?)GlcNAc(b1-?)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-3)GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-4)[Gal(b1-3)]GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)[Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-6)]Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-3)[Fuc(a1-4)]GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / O-GlcNAc / GlcNAc(b
- O-Linked / Undefined core / NeuAc(?2-3)Gal(?1-?)GlcNAc(?1-3)Gal(?1-3)[Gal(?1-4)GlcNAc(?1-6)]GalNAc+"+ Fuc"
- O-Linked / Undefined core / Fuc(?1-?)Gal(?1-?)[Fuc(?1-?)]GlcNAc(?1-?)Gal(?1-?)GlcNAc(?1-?)[NeuAc(?2-?)Gal(?1-?)]GalNAc
- O-Linked / Undefined core / Gal(?1-?)GlcNAc(?1-?)Gal(?1-?)[Fuc(?1-?)]GlcNAc(?1-?)[NeuAc(?2-?)Gal(?1-?)]GalNAc+"+ Fuc"
- O-Linked / Undefined core / Gal(?1-?)GlcNAc(?1-?)Gal(?1-?)GlcNAc(?1-?)Gal(?1-?)GlcNAc(?1-?)[NeuAc(?2-?)Gal(?1-?)]GalNAc
- O-Linked / Undefined core / Fuc(?1-?)Gal(?1-?)[Fuc(?1-?)]GlcNAc(?1-?)Gal(?1-?)[Fuc(?1-?)]GlcNAc(?1-?)[NeuAc(?2-?)Gal(?1-?)]GalNAc
Reported structure
- HexNAc:1 (avg mass : 221.2103 )
- HexNAc:1 dHex:1 (avg mass : 367.3533 )
- HexNAc:2 (avg mass : 424.4053 )
- HexNAc:2 dHex:1 (avg mass : 570.5483 )
- Hex:1 HexNAc:1 (avg mass : 383.3527 )
- Hex:1 HexNAc:1 NeuAc:1 (avg mass : 674.6106 )
- Hex:1 HexNAc:1 NeuAc:2 (avg mass : 965.8685 )
- Hex:1 HexNAc:1 dHex:1 NeuAc:1 (avg mass : 820.7536 )
- Hex:1 HexNAc:2 (avg mass : 586.5477 )
- Hex:1 HexNAc:2 NeuAc:1 (avg mass : 877.8056 )
- Hex:1 HexNAc:2 dHex:1 (avg mass : 732.6907 )
- Hex:1 HexNAc:3 dHex:1 (avg mass : 935.8857 )
- Hex:1 HexNAc:3 dHex:2 (avg mass : 1082.0287 )
- Hex:2 (avg mass : 342.3001 )
- Hex:2 Su:1 (avg mass : 422.3643 )
- Hex:2 NeuAc:1 (avg mass : 633.558 )
- Hex:2 NeuAc:1 Ac:1 (avg mass : 675.5947 )
- Hex:2 NeuAc:1 Su:1 (avg mass : 713.6222 )
- Hex:2 dHex:1 (avg mass : 488.4431 )
- Hex:2 dHex:1 NeuAc:1 (avg mass : 779.701 )
- Hex:2 dHex:2 (avg mass : 634.5861 )
- Hex:2 HexNAc:1 (avg mass : 545.4951 )
- Hex:2 HexNAc:1 dHex:1 (avg mass : 691.6381 )
- Hex:2 HexNAc:1 dHex:1 NeuAc:1 (avg mass : 982.896 )
- Hex:2 HexNAc:1 dHex:2 (avg mass : 837.7811 )
- Hex:2 HexNAc:2 (avg mass : 748.6901 )
- Hex:2 HexNAc:2 NeuAc:1 (avg mass : 1039.948 )
- Hex:2 HexNAc:2 NeuAc:2 (avg mass : 1331.2059 )
- Hex:2 HexNAc:2 dHex:1 (avg mass : 894.8331 )
- Hex:2 HexNAc:2 dHex:1 NeuAc:1 (avg mass : 1186.091 )
- Hex:2 HexNAc:3 (avg mass : 951.8851 )
- Hex:2 HexNAc:3 dHex:1 (avg mass : 1098.0281 )
- Hex:3 (avg mass : 504.4425 )
- Hex:3 dHex:1 (avg mass : 650.5855 )
- Hex:3 dHex:2 (avg mass : 796.7285 )
- Hex:3 HexNAc:1 (avg mass : 707.6375 )
- Hex:3 HexNAc:1 NeuAc:1 (avg mass : 998.8954 )
- Hex:3 HexNAc:1 NeuAc:2 (avg mass : 1290.1533 )
- Hex:3 HexNAc:1 dHex:1 (avg mass : 853.7805 )
- Hex:3 HexNAc:1 dHex:1 NeuAc:1 (avg mass : 1145.0384 )
- Hex:3 HexNAc:1 dHex:1 NeuAc:2 (avg mass : 1436.2963 )
- Hex:3 HexNAc:1 dHex:2 (avg mass : 999.9235 )
- Hex:3 HexNAc:2 (avg mass : 910.8325 )
- Hex:3 HexNAc:2 dHex:1 (avg mass : 1056.9755 )
- Hex:3 HexNAc:2 dHex:2 (avg mass : 1203.1185 )
- Hex:3 HexNAc:3 (avg mass : 1114.0275 )
- Hex:3 HexNAc:3 NeuAc:1 (avg mass : 1405.2854 )
- Hex:3 HexNAc:3 NeuAc:2 (avg mass : 1696.5433 )
- Hex:3 HexNAc:3 dHex:1 (avg mass : 1260.1705 )
- Hex:3 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 1551.4284 )
- Hex:3 HexNAc:3 dHex:2 (avg mass : 1406.3135 )
- Hex:3 HexNAc:3 dHex:2 NeuAc:1 (avg mass : 1697.5714 )
- Hex:3 HexNAc:3 dHex:3 NeuAc:1 (avg mass : 1843.7144 )
- Hex:3 HexNAc:4 (avg mass : 1317.2225 )
- Hex:3 HexNAc:4 NeuAc:1 (avg mass : 1608.4804 )
- Hex:3 HexNAc:4 dHex:1 (avg mass : 1463.3655 )
- Hex:3 HexNAc:4 dHex:2 (avg mass : 1609.5085 )
- Hex:3 HexNAc:4 dHex:3 (avg mass : 1755.6515 )
- Hex:3 HexNAc:5 (avg mass : 1520.4175 )
- Hex:3 HexNAc:5 dHex:1 (avg mass : 1666.5605 )
- Hex:3 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 1957.8184 )
- Hex:3 HexNAc:6 (avg mass : 1723.6125 )
- Hex:3 HexNAc:6 dHex:1 (avg mass : 1869.7555 )
- Hex:3 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2161.0134 )
- Hex:3 HexNAc:6 dHex:2 NeuAc:1 (avg mass : 2307.1564 )
- Hex:3 HexNAc:6 dHex:3 (avg mass : 2162.0415 )
- Hex:3 HexNAc:7 (avg mass : 1926.8075 )
- Hex:3 HexNAc:7 dHex:1 (avg mass : 2072.9505 )
- Hex:3 HexNAc:8 (avg mass : 2130.0025 )
- Hex:3 HexNAc:8 dHex:1 (avg mass : 2276.1455 )
- Hex:3 HexNAc:9 (avg mass : 2333.1975 )
- Hex:3 HexNAc:9 dHex:1 (avg mass : 2479.3405 )
- Hex:4 HexNAc:1 (avg mass : 869.7799 )
- Hex:4 HexNAc:1 dHex:1 (avg mass : 1015.9229 )
- Hex:4 HexNAc:1 dHex:1 NeuAc:1 (avg mass : 1307.1808 )
- Hex:4 HexNAc:1 dHex:2 (avg mass : 1162.0659 )
- Hex:4 HexNAc:2 (avg mass : 1072.9749 )
- Hex:4 HexNAc:2 NeuAc:1 (avg mass : 1364.2328 )
- Hex:4 HexNAc:2 NeuAc:2 (avg mass : 1655.4907 )
- Hex:4 HexNAc:2 NeuAc:3 (avg mass : 1946.7486 )
- Hex:4 HexNAc:2 dHex:1 (avg mass : 1219.1179 )
- Hex:4 HexNAc:2 dHex:1 NeuAc:1 (avg mass : 1510.3758 )
- Hex:4 HexNAc:2 dHex:1 NeuAc:2 (avg mass : 1801.6337 )
- Hex:4 HexNAc:2 dHex:2 (avg mass : 1365.2609 )
- Hex:4 HexNAc:2 dHex:2 NeuAc:1 (avg mass : 1656.5188 )
- Hex:4 HexNAc:2 dHex:3 (avg mass : 1511.4039 )
- Hex:4 HexNAc:2 dHex:4 (avg mass : 1657.5469 )
- Hex:4 HexNAc:3 (avg mass : 1276.1699 )
- Hex:4 HexNAc:3 NeuAc:1 (avg mass : 1567.4278 )
- Hex:4 HexNAc:3 dHex:1 (avg mass : 1422.3129 )
- Hex:4 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 1713.5708 )
- Hex:4 HexNAc:3 dHex:2 (avg mass : 1568.4559 )
- Hex:4 HexNAc:4 (avg mass : 1479.3649 )
- Hex:4 HexNAc:4 NeuAc:1 (avg mass : 1770.6228 )
- Hex:4 HexNAc:4 NeuAc:2 (avg mass : 2061.8807 )
- Hex:4 HexNAc:4 dHex:1 (avg mass : 1625.5079 )
- Hex:4 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 1916.7658 )
- Hex:4 HexNAc:4 dHex:2 (avg mass : 1771.6509 )
- Hex:4 HexNAc:4 dHex:2 NeuAc:1 (avg mass : 2062.9088 )
- Hex:4 HexNAc:4 dHex:3 NeuAc:1 (avg mass : 2209.0518 )
- Hex:4 HexNAc:5 (avg mass : 1682.5599 )
- Hex:4 HexNAc:5 NeuAc:1 (avg mass : 1973.8178 )
- Hex:4 HexNAc:5 NeuAc:2 (avg mass : 2265.0757 )
- Hex:4 HexNAc:5 dHex:1 (avg mass : 1828.7029 )
- Hex:4 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2119.9608 )
- Hex:4 HexNAc:5 dHex:1 NeuAc:2 (avg mass : 2411.2187 )
- Hex:4 HexNAc:5 dHex:2 (avg mass : 1974.8459 )
- Hex:4 HexNAc:5 dHex:2 NeuAc:1 (avg mass : 2266.1038 )
- Hex:4 HexNAc:6 (avg mass : 1885.7549 )
- Hex:4 HexNAc:6 NeuAc:1 (avg mass : 2177.0128 )
- Hex:4 HexNAc:6 dHex:1 (avg mass : 2031.8979 )
- Hex:4 HexNAc:6 dHex:2 (avg mass : 2178.0409 )
- Hex:4 HexNAc:7 (avg mass : 2088.9499 )
- Hex:4 HexNAc:7 dHex:1 (avg mass : 2235.0929 )
- Hex:4 HexNAc:8 (avg mass : 2292.1449 )
- Hex:4 HexNAc:9 (avg mass : 2495.3399 )
- Hex:5 (avg mass : 828.7273 )
- Hex:5 HexNAc:1 (avg mass : 1031.9223 )
- Hex:5 HexNAc:2 (avg mass : 1235.1173 )
- Hex:5 HexNAc:2 dHex:1 (avg mass : 1381.2603 )
- Hex:5 HexNAc:2 dHex:2 (avg mass : 1527.4033 )
- Hex:5 HexNAc:2 dHex:3 (avg mass : 1673.5463 )
- Hex:5 HexNAc:3 (avg mass : 1438.3123 )
- Hex:5 HexNAc:3 NeuAc:1 (avg mass : 1729.5702 )
- Hex:5 HexNAc:3 dHex:1 (avg mass : 1584.4553 )
- Hex:5 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 1875.7132 )
- Hex:5 HexNAc:3 dHex:1 NeuAc:2 (avg mass : 2166.9711 )
- Hex:5 HexNAc:3 dHex:2 (avg mass : 1730.5983 )
- Hex:5 HexNAc:3 dHex:2 NeuAc:1 (avg mass : 2021.8562 )
- Hex:5 HexNAc:3 dHex:3 (avg mass : 1876.7413 )
- Hex:5 HexNAc:3 dHex:3 NeuAc:1 (avg mass : 2167.9992 )
- Hex:5 HexNAc:3 dHex:4 (avg mass : 2022.8843 )
- Hex:5 HexNAc:3 dHex:5 (avg mass : 2169.0273 )
- Hex:5 HexNAc:4 (avg mass : 1641.5073 )
- Hex:5 HexNAc:4 NeuAc:1 (avg mass : 1932.7652 )
- Hex:5 HexNAc:4 NeuAc:2 (avg mass : 2224.0231 )
- Hex:5 HexNAc:4 dHex:1 (avg mass : 1787.6503 )
- Hex:5 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 2078.9082 )
- Hex:5 HexNAc:4 dHex:1 NeuAc:2 (avg mass : 2370.1661 )
- Hex:5 HexNAc:4 dHex:2 (avg mass : 1933.7933 )
- Hex:5 HexNAc:4 dHex:2 NeuAc:1 (avg mass : 2225.0512 )
- Hex:5 HexNAc:4 dHex:3 (avg mass : 2079.9363 )
- Hex:5 HexNAc:4 dHex:3 NeuAc:1 (avg mass : 2371.1942 )
- Hex:5 HexNAc:4 dHex:3 NeuAc:2 (avg mass : 2662.4521 )
- Hex:5 HexNAc:4 dHex:4 (avg mass : 2226.0793 )
- Hex:5 HexNAc:5 (avg mass : 1844.7023 )
- Hex:5 HexNAc:5 NeuAc:1 (avg mass : 2135.9602 )
- Hex:5 HexNAc:5 NeuAc:2 (avg mass : 2427.2181 )
- Hex:5 HexNAc:5 dHex:1 (avg mass : 1990.8453 )
- Hex:5 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2282.1032 )
- Hex:5 HexNAc:5 dHex:1 NeuAc:2 (avg mass : 2573.3611 )
- Hex:5 HexNAc:5 dHex:2 (avg mass : 2136.9883 )
- Hex:5 HexNAc:5 dHex:2 NeuAc:3 (avg mass : 3010.762 )
- Hex:5 HexNAc:5 dHex:3 (avg mass : 2283.1313 )
- Hex:5 HexNAc:5 dHex:3 NeuAc:2 (avg mass : 2865.6471 )
- Hex:5 HexNAc:6 (avg mass : 2047.8973 )
- Hex:5 HexNAc:6 dHex:1 (avg mass : 2194.0403 )
- Hex:5 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2485.2982 )
- Hex:5 HexNAc:6 dHex:1 NeuAc:2 (avg mass : 2776.5561 )
- Hex:5 HexNAc:8 (avg mass : 2454.2873 )
- Hex:5 HexNAc:8 dHex:1 (avg mass : 2600.4303 )
- Hex:6 HexNAc:2 (avg mass : 1397.2597 )
- Hex:6 HexNAc:2 dHex:2 (avg mass : 1689.5457 )
- Hex:6 HexNAc:2 dHex:3 (avg mass : 1835.6887 )
- Hex:6 HexNAc:3 (avg mass : 1600.4547 )
- Hex:6 HexNAc:3 NeuAc:1 (avg mass : 1891.7126 )
- Hex:6 HexNAc:3 dHex:1 (avg mass : 1746.5977 )
- Hex:6 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 2037.8556 )
- Hex:6 HexNAc:4 (avg mass : 1803.6497 )
- Hex:6 HexNAc:4 NeuAc:1 (avg mass : 2094.9076 )
- Hex:6 HexNAc:4 dHex:1 (avg mass : 1949.7927 )
- Hex:6 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 2241.0506 )
- Hex:6 HexNAc:4 dHex:1 NeuAc:2 (avg mass : 2532.3085 )
- Hex:6 HexNAc:4 dHex:2 (avg mass : 2095.9357 )
- Hex:6 HexNAc:4 dHex:3 (avg mass : 2242.0787 )
- Hex:6 HexNAc:4 dHex:3 NeuAc:1 (avg mass : 2533.3366 )
- Hex:6 HexNAc:4 dHex:4 (avg mass : 2388.2217 )
- Hex:6 HexNAc:5 (avg mass : 2006.8447 )
- Hex:6 HexNAc:5 NeuAc:1 (avg mass : 2298.1026 )
- Hex:6 HexNAc:5 NeuAc:2 (avg mass : 2589.3605 )
- Hex:6 HexNAc:5 NeuAc:3 (avg mass : 2880.6184 )
- Hex:6 HexNAc:5 dHex:1 (avg mass : 2152.9877 )
- Hex:6 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2444.2456 )
- Hex:6 HexNAc:5 dHex:1 NeuAc:2 (avg mass : 2735.5035 )
- Hex:6 HexNAc:5 dHex:1 NeuAc:3 (avg mass : 3026.7614 )
- Hex:6 HexNAc:5 dHex:2 (avg mass : 2299.1307 )
- Hex:6 HexNAc:5 dHex:2 NeuAc:1 (avg mass : 2590.3886 )
- Hex:6 HexNAc:5 dHex:3 (avg mass : 2445.2737 )
- Hex:6 HexNAc:5 dHex:3 NeuAc:1 (avg mass : 2736.5316 )
- Hex:6 HexNAc:6 (avg mass : 2210.0397 )
- Hex:6 HexNAc:6 NeuAc:1 (avg mass : 2501.2976 )
- Hex:6 HexNAc:6 NeuAc:2 (avg mass : 2792.5555 )
- Hex:6 HexNAc:6 dHex:1 (avg mass : 2356.1827 )
- Hex:6 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2647.4406 )
- Hex:6 HexNAc:6 dHex:1 NeuAc:2 (avg mass : 2938.6985 )
- Hex:6 HexNAc:6 dHex:2 (avg mass : 2502.3257 )
- Hex:6 HexNAc:6 dHex:3 (avg mass : 2648.4687 )
- Hex:6 HexNAc:7 (avg mass : 2413.2347 )
- Hex:6 HexNAc:7 dHex:1 (avg mass : 2559.3777 )
- Hex:6 HexNAc:8 (avg mass : 2616.4297 )
- Hex:7 (avg mass : 1153.0121 )
- Hex:7 HexNAc:2 (avg mass : 1559.4021 )
- Hex:7 HexNAc:4 (avg mass : 1965.7921 )
- Hex:7 HexNAc:4 NeuAc:1 (avg mass : 2257.05 )
- Hex:7 HexNAc:4 dHex:1 (avg mass : 2111.9351 )
- Hex:7 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 2403.193 )
- Hex:7 HexNAc:5 (avg mass : 2168.9871 )
- Hex:7 HexNAc:5 dHex:1 (avg mass : 2315.1301 )
- Hex:7 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2606.388 )
- Hex:7 HexNAc:5 dHex:1 NeuAc:2 (avg mass : 2897.6459 )
- Hex:7 HexNAc:5 dHex:2 (avg mass : 2461.2731 )
- Hex:7 HexNAc:5 dHex:2 NeuAc:1 (avg mass : 2752.531 )
- Hex:7 HexNAc:5 dHex:3 (avg mass : 2607.4161 )
- Hex:7 HexNAc:5 dHex:4 (avg mass : 2753.5591 )
- Hex:7 HexNAc:6 (avg mass : 2372.1821 )
- Hex:7 HexNAc:6 NeuAc:1 (avg mass : 2663.44 )
- Hex:7 HexNAc:6 NeuAc:2 (avg mass : 2954.6979 )
- Hex:7 HexNAc:6 NeuAc:3 (avg mass : 3245.9558 )
- Hex:7 HexNAc:6 NeuAc:4 (avg mass : 3537.2137 )
- Hex:7 HexNAc:6 dHex:1 (avg mass : 2518.3251 )
- Hex:7 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2809.583 )
- Hex:7 HexNAc:6 dHex:1 NeuAc:2 (avg mass : 3100.8409 )
- Hex:7 HexNAc:6 dHex:1 NeuAc:3 (avg mass : 3392.0988 )
- Hex:7 HexNAc:6 dHex:1 NeuAc:4 (avg mass : 3683.3567 )
- Hex:7 HexNAc:6 dHex:2 (avg mass : 2664.4681 )
- Hex:7 HexNAc:6 dHex:4 (avg mass : 2956.7541 )
- Hex:7 HexNAc:6 dHex:4 NeuAc:1 (avg mass : 3248.012 )
- Hex:7 HexNAc:6 dHex:5 (avg mass : 3102.8971 )
- Hex:7 HexNAc:7 (avg mass : 2575.3771 )
- Hex:7 HexNAc:7 dHex:1 (avg mass : 2721.5201 )
- Hex:7 HexNAc:7 dHex:1 NeuAc:2 (avg mass : 3304.0359 )
- Hex:8 (avg mass : 1315.1545 )
- Hex:8 HexNAc:2 (avg mass : 1721.5445 )
- Hex:8 HexNAc:5 (avg mass : 2331.1295 )
- Hex:8 HexNAc:5 dHex:1 (avg mass : 2477.2725 )
- Hex:8 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2971.7254 )
- Hex:8 HexNAc:6 dHex:2 (avg mass : 2826.6105 )
- Hex:8 HexNAc:6 dHex:3 (avg mass : 2972.7535 )
- Hex:8 HexNAc:7 (avg mass : 2737.5195 )
- Hex:8 HexNAc:7 NeuAc:1 (avg mass : 3028.7774 )
- Hex:8 HexNAc:7 dHex:1 (avg mass : 2883.6625 )
- Hex:8 HexNAc:7 dHex:1 NeuAc:1 (avg mass : 3174.9204 )
- Hex:8 HexNAc:7 dHex:1 NeuAc:2 (avg mass : 3466.1783 )
- Hex:9 HexNAc:2 (avg mass : 1883.6869 )
- Hex:9 HexNAc:6 (avg mass : 2696.4669 )
- Hex:9 HexNAc:8 (avg mass : 3102.8569 )
- Hex:9 HexNAc:8 dHex:1 (avg mass : 3248.9999 )
- Hex:10 HexNAc:2 (avg mass : 2045.8293 )
- Hex:10 HexNAc:9 (avg mass : 3468.1943 )
- Hex:10 HexNAc:9 dHex:1 (avg mass : 3614.3373 )
- Hex:11 HexNAc:2 (avg mass : 2207.9717 )
Composition
Disease
- Increasing the Coverage of a Mass Spectral Library of Milk Oligosaccharides Using a Hybrid-Search-Based Bootstrapping Method and Milks from a Wide Variety of Mammals (2020 - Concepcion Africano Remoroza, Yuxue Liang, Tytus D. Mak, Yuri Mirokhin, Sergey L. Sheetlin, Xiaoyu Yang, Joice V. San Andres, Michael L. Power, and Stephen E. Stein) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Impact of maternal characteristics on human milk oligosaccharide composition over the first 4 months of lactation in a cohort of healthy European mothers (2019 - Tinu Mary Samuel, Aristea Binia, Carlos Antonio de Castro, Sagar K. Thakkar, Claude Billeaud, Massimo Agosti, Isam Al-Jashi, Maria Jose Costeira, Giovanna Marchini, Cecilia Martínez-Costa, Jean-Charles Picaud, Tom Stiris, Silvia-Maria Stoicescu, Mireille Vanpeé, Magnus Domellöf, Sean Austin & Norbert Sprenger) / Status : Reviewed
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Reviewed
- Synthesis of Asymmetrical Multiantennary Human Milk Oligosaccharides (2017 - Anthony R Prudden, Lin Liu, Chantelle J Capicciotti, Margreet A Wolfert, Shuo Wang, Zhongwei Gao, Lu Meng, Kelley W Moremen, Geert-Jan Boons) / Status : Reviewed
- Systematic Review of the Concentrations of Oligosaccharides in Human Milk (2017 - Stephan Thurl, Manfred Munzert, Günther Boehm, Catherine Matthews, Bernd Stahl) / Status : Reviewed
- Human Milk Oligosaccharides (HMOS): Structure, Function, and Enzyme-Catalyzed Synthesis (2015 - Xi Chen) / Status : Reviewed
- Identification of protein O-glycosylation site and corresponding glycans using liquid chromatography-tandem mass spectrometry via mapping accurate mass and retention time shift (2014 - Huang LJ, Lin JH, Tsai JH, Chu YY, Chen YW, Chen SL, Chen SH) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- Annotation and Structural Analysis of Sialylated Human Milk Oligosaccharides (2011 - Shuai Wu, Rudolf Grimm, J Bruce German, Carlito B Lebrilla) / Status : Reviewed
- Development of an Annotated Library of Neutral Human Milk Oligosaccharides (2010 - Shuai Wu, Nannan Tao, J Bruce German, Rudolf Grimm, Carlito B Lebrilla) / Status : Reviewed
- Comparison of oligosaccharides in milk specimens from humans and twelve other species. (2001 - Warren CD, Chaturvedi P, Newburg AR, Oftedal OT, Tilden CD, Newburg DS) / Status : Reviewed
- N-glycosylation potential of maize: the human lactoferrin used as a model. (2001 - Samyn-Petit B, Gruber V, Flahaut C, Wajda-Dubos JP, Farrer S, Pons A, Desmaizieres G, Slomianny MC, Theisen M, Delannoy P) / Status : Reviewed
- Fucosylated human milk oligosaccharides vary between individuals and over the course of lactation (2001 - Chaturvedi, Warren, Altaye, Morrow, Ruiz-Palacios, Pickering, Newburg) / Status : Reviewed
- Chemical characterization of milk oligosaccharides of the polar bear, Ursus maritimus. (2000 - Urashima T, Yamashita T, Nakamura T, Arai I, Saito T, Derocher A, Wiig O) / Status : Reviewed
- High-performance capillary electrophoresis of sialylated oligosaccharides of human milk. (2000 - Shen Z, Warren C, Newburg D) / Status : Reviewed
- Structural characterization of the N-linked oligosaccharides in bile salt-stimulated lipase originated from human breast milk. (1999 - Mechref Y, Chen P, Novotny M) / Status : Reviewed
- Chemical characterisation of the oligosaccharides in a sample of milk of a white-nosed coati, Nasua narica (Procyonidae: Carnivora). (1999 - Urashima T, Yamamoto M, Nakamura T, Arai I, Saito T, Namiki M, Yamaoka K, Kawahara K) / Status : Reviewed
- Chemical characterization of milk oligosaccharides of the Japanese black bear, Ursus thibetanus japonicus. (1999 - Urashima T, Sumiyoshi W, Nakamura T, Arai I, Saito T, Komatsu T, Tsubota T) / Status : Reviewed
- A novel pentasaccharide from immunostimulant oligosaccharide fraction of buffalo milk. (1999 - Saksena R, Deepak D, Khare A, Sahai R, Tripathi L, Srivastava V) / Status : Reviewed
- Occurrence of an unusual lactose sulfate in dog milk. (1999 - Bubb W, Urashima T, Kohso K, Nakamura T, Arai I, Saito T) / Status : Reviewed
- Structure of the O-glycopeptides isolated from bovine milk component PP3. (1998 - Coddeville B, Girardet J, Plancke Y, Campagna S, Linden G, Spik G) / Status : Reviewed
- Chemical characterization of milk oligosaccharides of the brown bear, Ursus arctos yesoensis. (1997 - Urashima T, Kusaka Y, Nakamura T, Saito T, Maeda N, Messer M) / Status : Reviewed
- Most bovine milk fat globule membrane glycoproteins contain asparagine-linked sugar chains with GalNAc beta 1-->4GlcNAc groups. (1993 - Sato T, Furukawa K, Greenwalt D, Kobata A) / Status : Reviewed
- Novel oligosaccharides with the sialyl-Lea structure in human milk. (1991 - Kitagawa H, Nakada H, Fukui S, Funakoshi I, Kawasaki T, Yamashina I, Tate S, Inagaki F) / Status : Reviewed
- Occurrence of tetra- and pentasaccharides with the sialyl-Le(a) structure in human milk. (1990 - Kitagawa H, Nakada H, Numata Y, Kurosaka A, Fukui S, Funakoshi I, Kawasaki T, Shimada I, Inagaki F, Yamashina I) / Status : Reviewed
- Structures of acidic O-linked polylactosaminoglycans on human skim milk mucins. (1990 - Hanisch F, Peter-Katalinic J, Egge H, Dabrowski U, Uhlenbruck G) / Status : Reviewed
- Three novel oligosaccharides with the sialyl-Lea structure in human milk: isolation by immunoaffinity chromatography. (1989 - Kitagawa H, Nakada H, Kurosaka A, Hiraiwa N, Numata Y, Fukui S, Funakoshi I, Kawasaki T, Yamashina I, Shimada I) / Status : Reviewed
- Primary structure of twenty three neutral and monosialylated oligosaccharides O-glycosidically linked to the human secretory immunoglobulin A hinge region determined by a combination of permethylation analysis and 400-MHz 1H-NMR spectroscopy. (1989 - Pierce-Cretel A, Decottignies J, Wieruszeski J, Strecker G, Montreuil J, Spik G) / Status : Reviewed
- Chemical structure of neutral sugar chains isolated from human mature milk kappa-casein. (1988 - Saito T, Itoh T, Adachi S) / Status : Reviewed
- A new sialyloligosaccharide from human milk: isolation and characterization using anti-oligosaccharide antibodies. (1984 - Prieto PA, Smith DF) / Status : Reviewed
- 13C-N.m.r. study of the structures of two branched oligosaccharides from marsupial milk. (1983 - Bradbury J, Collins J, Jenkins G, Trifonoff E, Messer M) / Status : Reviewed
- Primary structure of the N-glycosidically linked sialoglycans of secretory immunoglobulins A from human milk. (1982 - Pierce-Cretel A, Pamblanco M, Strecker G, Montreuil J, Spik G, Dorland L, Van Halbeek H, Vliegenthart J) / Status : Reviewed
- Structure of a branched tetrasaccharide from marsupial milk. (1982 - Messer M, Trifonoff E) / Status : Reviewed
- Structural studies of 4-O-acetyl-alpha-N-acetylneuraminyl-(2 goes to 3)-lactose, the main oligosaccharide in echidna milk. (1982 - Kamerling J, Dorland L, van Halbeek H, Vliegenthart J, Messer M, Schauer R) / Status : Reviewed
- Primary structure of the glycans from human lactotransferrin. (1982 - Spik G, Strecker G, Fournet B, Bouquelet S, Montreuil J, Dorland L, van Halbeek H, Vliegenthart J) / Status : Reviewed
- Structural study of the sugar chains of human lactoferrin: finding of four novel complex-type asparagine-linked sugar chains. (1982 - Matsumoto A, Yoshima H, Takasaki S, Kobata A) / Status : Reviewed
- Heterogeneity of the glycans O-glycosidically linked to the hinge region of secretory immunoglobulins from human milk. (1981 - Pierce-Cretel A, Pamblanco M, Strecker G, Montreuil J, Spik G) / Status : Reviewed
- Structure of a marsupial-mild trisaccharide. (1980 - Messer M, Trifonoff E, Stern W, Collins J, Bradbury J) / Status : Reviewed
- A 360-MHz 1H-NMR study of three oligosaccharides isolated from cow kappa-casein. (1980 - van Halbeek H, Dorland L, Vliegenthart J, Fiat A, Jolles P) / Status : Reviewed
- The chemical structure of the main sugar moiety isolated from bovine whole casein. (1980 - Saito T, Itoh T, Adachi S) / Status : Reviewed
- Structure of the carbohydrate chain of free secretory component from human milk. (1979 - Purkayastha S, Rao C, Lamm M) / Status : Reviewed
- Cow kappa-casein: structure of the carbohydrate portion. (1979 - Fournet B, Fiat A, Alais C, Jolls P) / Status : Reviewed
- Fractionation of sialyl oligosaccharides of human milk by ion-exchange chromatography (1978 - David F. Smith, David A. Zorf, Victor Ginsburg) / Status : Reviewed
- Oligosaccharides of human milk: Structural studies of Di- and trifucosyl derivatives of lacto-N-octaose and lacto-N-neooctaose (1978 - Yoko Tachibana, Katsuko Yamashita, Akira Kobata) / Status : Reviewed
Reference
- ADAM DEC1 / Homo sapiens
- Afamin / Homo sapiens
- Alpha-1-acid glycoprotein 1 / Homo sapiens
- Alpha-1-acid glycoprotein 2 / Homo sapiens
- Alpha-1-antichymotrypsin / Homo sapiens
- Alpha-1-antitrypsin / Homo sapiens
- Alpha-1b-glycoprotein / Homo sapiens
- Alpha-2-HS-glycoprotein / Homo sapiens
- Alpha-L-iduronidase / Homo sapiens
- Alpha-S1-casein / Homo sapiens
- Angiopoietin-related protein 4 / Homo sapiens
- Angiotensin-converting enzyme / Homo sapiens
- Angiotensinogen / Homo sapiens
- Antithrombin-III / Homo sapiens
- Apolipoprotein B-100 / Homo sapiens
- Apolipoprotein D / Homo sapiens
- Attractin / Homo sapiens
- Beta-2-glycoprotein 1 / Homo sapiens
- Bile-salt-activated lipase / Homo sapiens
- Biotinidase / Homo sapiens
- Butyrophilin subfamily 1 member A1 / Homo sapiens
- Carbonic anhydrase 6 / Homo sapiens
- Cathepsin B / Homo sapiens
- CD59 glycoprotein / Homo sapiens
- CD63 antigen / Homo sapiens
- Ceroid-lipofuscinosis neuronal protein 5 / Homo sapiens
- Ceruloplasmin / Homo sapiens
- Chordin-like protein 2 / Homo sapiens
- Clusterin / Homo sapiens
- Complement C1r subcomponent-like protein / Homo sapiens
- Complement c3 / Homo sapiens
- Complement c4-a / Homo sapiens
- Complement C4-B / Homo sapiens
- Complement factor b / Homo sapiens
- Complement factor h / Homo sapiens
- Complement factor i / Homo sapiens
- Desmocollin-2 / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Ectonucleoside triphosphate diphosphohydrolase 3 / Homo sapiens
- Endoplasmin / Homo sapiens
- Ephrin-A1 / Homo sapiens
- Extracellular sulfatase Sulf-2 / Homo sapiens
- Fibrinogen beta chain / Homo sapiens
- Fibrinogen gamma chain / Homo sapiens
- Fibronectin / Homo sapiens
- Folate receptor alpha / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Gamma-glutamyltranspeptidase 1 / Homo sapiens
- Glucosylceramidase / Homo sapiens
- Haptoglobin / Homo sapiens
- Hemopexin / Homo sapiens
- Heparin cofactor 2 / Homo sapiens
- HLA class II histocompatibility antigen gamma chain / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Kallikrein-6 / Homo sapiens
-
Kappa casein / Homo sapiens
- Undefined site
- Kinesin-1 heavy chain / Homo sapiens
- Kininogen-1 / Homo sapiens
- Lactadherin / Homo sapiens
- Lactoperoxidase / Homo sapiens
- Lactotransferrin / Homo sapiens
- Legumain / Homo sapiens
- Leucine-rich alpha-2-glycoprotein / Homo sapiens
- Lipoprotein lipase / Homo sapiens
- Lumican / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Macrophage mannose receptor 1 / Homo sapiens
- Metalloproteinase inhibitor 1 / Homo sapiens
- Monocyte differentiation antigen cd14 / Homo sapiens
- Myeloperoxidase / Homo sapiens
- Myoferlin / Homo sapiens
- N-acetylglucosamine-1-phosphotransferase subunit gamma / Homo sapiens
- Natural cytotoxicity triggering receptor 3 ligand 1 / Homo sapiens
- Neuroblastoma suppressor of tumorigenicity 1 / Homo sapiens
- Neuropilin-1 / Homo sapiens
- Neutrophil gelatinase-associated lipocalin / Homo sapiens
- Nucleotide exchange factor SIL1 / Homo sapiens
- Olfactomedin-4 / Homo sapiens
- Palmitoyl-protein thioesterase 1 / Homo sapiens
- Peptidyl-prolyl cis-trans isomerase B / Homo sapiens
- Peptidyl-prolyl cis-trans isomerase C / Homo sapiens
- Phospholipid transfer protein / Homo sapiens
- Plasma protease c1 inhibitor / Homo sapiens
- Platelet glycoprotein 4 / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Pro-epidermal growth factor / Homo sapiens
- Prosaposin / Homo sapiens
- Prothrombin / Homo sapiens
- Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
- Recombinant Mucin-1 Muc1f/4tr / Homo sapiens
- Sclerostin domain-containing protein 1 / Homo sapiens
- Selenoprotein P / Homo sapiens
- Serotransferrin / Homo sapiens
- Serum paraoxonase/arylesterase 1 / Homo sapiens
- Sortilin / Homo sapiens
- Sparc-like protein 1 / Homo sapiens
- Sulfhydryl oxidase 1 / Homo sapiens
- Tenascin / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Tissue alpha-L-fucosidase / Homo sapiens
- Toll-like receptor 2 / Homo sapiens
- Trans-Golgi network integral membrane protein 2 / Homo sapiens
- Transcobalamin-1 / Homo sapiens
- Tumor necrosis factor ligand superfamily member 13 / Homo sapiens
- Tumor necrosis factor receptor superfamily member 11B / Homo sapiens
-
Unspecified mucin / Homo sapiens
- Undefined site
- Vitronectin / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
-
Casein / Bos taurus
- Undefined site
- Kappa casein / Bos taurus
- Lactophorin / Bos taurus
- Lactotransferrin / Bos taurus
-
Uncharacterized protein from Milk / Bos taurus
- Undefined site
Reported glycosite
- RHTVFWNSSNPKF (13aa)
- RDIENFNSTQKF (12aa)
- KNVTLHVPSKLDAEKL (16aa)
- KNVTLHVPSKL (11aa)
- KRQSGVNATLPEENQPVVFNHVYNIKL (27aa)
- KRNTTWQAGHNFYNVDMSYLKR (22aa)
- RQSGVNATLPEENQPVVFNHVYNIKL (26aa)
- KQEEAGVRPSAGNVSTHPSLSQRPGGSTKS (30aa)
- KNITQIVGHSGCEAKS (16aa)
- KTAVNCSSDFDACLITKA (18aa)
- KNNSDISSTRGFPSVLRGGKY (21aa)
- KYKNNSDISSTRG (13aa)
- KNNSDISSTRG (11aa)
- KNDATEILYSHVVKPVPAHPSSNSTLNQARN (31aa)
- RVYIHPFHLVIHNESTCEQLAKA (23aa)
- KNLSMPLLPADFHKE (15aa)
- RDVNCSVMGPQEKK (14aa)
- KFVGTPEVNQTTLYQRY (17aa)
- RLSPNASAEHLELRW (15aa)
- KWFYIASAFRNEEYNKS (17aa)
- KEGHFYYNISEVKV (14aa)
- KGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRM (34aa)
- KQTDEIKDTRNESTQNCVVAEPEKM (25aa)
- RNESTQNCVVAEPEKM (16aa)
- RALGFENATQALGRA (15aa)
- REKQTDEIKDTRNESTQNCVVAEPEKM (27aa)
- KDTRNESTQNCVVAEPEKMESSISSSSEEMSLSKC (35aa)
- KDTRNESTQNCVVAEPEKM (19aa)
- RTPEDTAEDTCHLIPGVAESVATCHFNHSSKT (32aa)
- RIIVPLNNRENISDPTSPLRT (21aa)
- RENISDPTSPLRT (13aa)
- RIIVPLNNRENISDPTSPLRTRF (23aa)
- RSLGSGGSVSQLFSNFTGSVDDRG (24aa)
- KSVQEIQATFFYFTPNKT (18aa)
- KDLQSLEDILHQVENKT (17aa)
- KDNATEEEILVYLEKT (16aa)
- KENNTGVVSQTFKC (14aa)
- KEGYSNISYIVVNHQGISSRL (21aa)
- KTVLTPATNHMGNVTFTIPANREFKS (26aa)
- KTVLTPATNHMGNVTFTIPANRE (23aa)
- KSYNVTSVLFRK (12aa)
- KNNATVHEQVGGPSLTSDLQAQSKG (25aa)
- KKKEDALNETRE (12aa)
- KKKEDALNETRESETKL (17aa)
- KEDALNETRESETKL (15aa)
- KKEDALNETRESETKL (16aa)
- KEDALNETRE (10aa)
- KKEDALNETRE (11aa)
- KYEFCPFHNVTQHEQTFRW (19aa)
- KYAGRANLTNFPENGTFVVNIAQLSQDDSGRYKC (34aa)
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- RANLTNFPENGTFVVNIAQLSQDDSGRYKC (30aa)
- KYAGRANLTNFPENGTFVVNIAQLSQDDSGRY (32aa)
- RQDQCIYNTTYLNVQRE (17aa)
- RADGTVNQIEGEATPVNLTEPAKL (24aa)
- KLANNTHQHVFDDLRG (16aa)
- KTCDWLPKPNMSASCKE (17aa)
- RSHNRSEEFLIAGKL (15aa)
- KELPGVCNETMMALWEECKPCLKQ (24aa)
- RGHTLTLNFTRN (12aa)
- RVFLNGSRQERV (12aa)
- KWECKNDTLLGIKGEDLFFNYGNRQ (25aa)
- KWECKNDTLLGIKG (14aa)
- KNDTLLGIKG (10aa)
- KFNLTETSEAEIHQSFQHLLRT (22aa)
- KYVHNHNTYTNNENCSSPSWQAQHESRT (28aa)
- KDIVEYYNDSNGSHVLQGRF (20aa)
- KSCQHNGTMYQHGEIFSAHELFPSRL (26aa)
- KVSEHIPVYQQEENQTDVWTLLNGSKD (27aa)
- KQHSVLHLVPINATSKD (17aa)
- KKLHINHNNLTESVGPLPKS (20aa)
- KLHINHNNLTESVGPLPKS (19aa)
- RTLNQSSDELQLSMGNAMFVKE (22aa)
- KDIVEYYNDSNGSHVLQGRFGCEIENNRS (29aa)
- KLGACNDTLQQLMEVFKF (18aa)
- RFGCEIENNRS (11aa)
- KNNHTASILDRM (12aa)
- KNGSGAVFPVAGADVQTLRE (20aa)
- KNNHTASILDRMQADFKC (18aa)
- RDCSANTTSCHILGWGKT (18aa)
- RGLSFDVSLEVSQGPGLLNDTKV (23aa)
- KYGNMTEDHVMHLLQNADPLKV (22aa)
- KLLNLTVRI (9aa)
- KEHEGAIYPDNTTDFQRA (18aa)
- KEHEGAIYPDNTTDFQRADDKV (22aa)
- RSPYYNVSDEISFHCYDGYTLRGSANRT (28aa)
- KVSNVSCQASVSRM (14aa)
- RLSLHRPALEDLLLGSEANLTCTLTGLRD (29aa)
- KDTNGSQFFITTVKT (15aa)
- KRGPECSQNYTTPSGVIKS (19aa)
- RWNPCLEPHRFNDTEVLQRL (20aa)
- RLRNVSWATGRS (12aa)
- RNVSWATGRS (10aa)
- KRCPDGFFSNETSSKA (16aa)
- KVCQDCPLLAPLNDTRV (17aa)
- RRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (33aa)
- RKVCQDCPLLAPLNDTRV (18aa)
- RTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (32aa)
- KGWNWTSGFNKC (12aa)
- RVYKPSAGNNSLYRD (15aa)
- RGNFSTEGCGCVCEPGWKG (19aa)
- KDLNETIHYMYKH (13aa)
- KREENQEQPRNYSHHQLNRS (20aa)
- KAALAAFNAQNNGSNFQLEEISRA (24aa)
- REEQFNSTFRV (11aa)
- KTKPREEQFNSTFRV (15aa)
- KRLPEMAQPVDPAHNVSRL (19aa)
- KLSDLSINSTECLHVHCRG (19aa)
- REGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYRT (35aa)
- REEQYNSTYRV (11aa)
- KTKPREEQYNSTYRV (15aa)
- KGPNCSEPECPGNCHLRG (18aa)
- KEHAVFTSNQEEQDPANHTCGVKS (24aa)
- KMVSHHNLTTGATLINEQWLLTTAKN (26aa)
- RTYTYADTPDDFQLHNFSLPEEDTKL (26aa)
- RKLPPGLLANFTLLRT (16aa)
- KQIGLYPVLVIDSSGYVNPNYTGRI (25aa)
- KQIGLYPVLVIDSSGYVNPNYTGRIRL (27aa)
- KLPPGLLANFTLLRT (15aa)
- KSLTFNETYQDISELVYGAKL (21aa)
- RSWPAVGNCSSALRW (15aa)
- KERSWPAVGNCSSALRW (17aa)
- KVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKI (35aa)
- KFNSSSSSLEEKI (13aa)
- KEDVYRNHSIFLADINQERG (20aa)
- KSIQNVSHLILHMKQ (15aa)
- KQDNETGIYYETWNVKA (17aa)
- KTPLTANITKS (11aa)
- KRNIAAFGGDPNNITLFGESAGGASVSLQTLSPYNKG (37aa)
- KNMDGTFNVTSCLKL (15aa)
- RGLTFQQNASSMCVPDQDTAIRV (23aa)
- KNLFLNHSENATAKD (15aa)
- KNVSCYIQNLLLGQEKK (17aa)
- KHNNDTQHIWESDSNEFSVIADPRG (25aa)
- RFSDGLESNSSTQFEVKK (18aa)
- KNNSIPDKQ (9aa)
- KGVTSVSQIFHSPDLAIRDTFVNASRT (27aa)
- KVVLHPNYSQVDIGLIKL (18aa)
- KDRQDGEEVLQCMPVCGRPVTPIAQNQTTLGSSRA (35aa)
- RNISDGFDGIPDNVDAALALPAHSYSGRE (29aa)
- RNGTGHGNSTHHGPEYMRC (19aa)
- KGCSSSTSVLLTLDNNVVNGSSPAIRT (27aa)
- RVLSNNSDANLELINTWVAKN (21aa)
- KLGNWSAMPSCKA (13aa)
- KHANWTLTPLKS (12aa)
- KLENSLLDHRNKT (13aa)
- RWGQNCSCHHGGYYNCEDKF (20aa)
- KYTGNASALFILPDQDKM (18aa)
- KYLGNATAIFFLPDEGKL (18aa)
- RCMWSSALNSLNLSFAGLEQVPKG (24aa)
- RHIGHANLTFEQLRS (15aa)
- REIRHNSTGCLRM (13aa)
- RHNSTGCLRM (10aa)
- KLNAENNATFYFKI (14aa)
- RTTIVICCSPSSYNESETKS (20aa)
- RDLGPTLANSTHHNVRL (17aa)
- KNCTSYGVLDISKC (14aa)
- RLRNLSSPLGLMAVNQEVSDHGLPYLPYDSKK (32aa)
- RNLSSPLGLMAVNQEVSDHGLPYLPYDSKK (30aa)
- KMFSQNDTRC (10aa)
- RCINGTCYCEEGFTGEDCGKPTCPHACHTQGRC (33aa)
- KVAYSNDSANWTEYQDPRT (19aa)
- KTIDRLAGKPTHVNVSVVMAEVDGTCY- (28aa)
- RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
- KTIDRLAGKPTHVNVSVVMAEVDGTCY (27aa)
- RLAGKPTHVNVSVVMAEVDGTCY (23aa)
- KKGNTTLNSFVIPSESDVPTHCPSQWWPYAGHCYKI (36aa)
- KGNTTLNSFVIPSESDVPTHCPSQWWPYAGHCYKI (35aa)
- KMLNTSSLLEQLNEQFNWVSRL (22aa)
- RNMSNQLGLLAVNQRF (16aa)
- RNLRNMSNQLGLLAVNQRF (19aa)
- KAGLQAFFQVQECNKS (16aa)
- KVSCPIMPCSNATVPDGECCPRC (23aa)
- KMNDTIFGFTMEERS (15aa)
- RFQVNNTRPPHVQLLRK (17aa)
- RLANLTQGEDQYYLRV (16aa)
- KYRGTAGNALMDGASQLMGENRT (23aa)
- RGTAGNALMDGASQLMGENRT (21aa)
- KENLTAPGSDSAVFFEQGTTRI (22aa)
- KGLNLTEDTYKPRI (14aa)
- RIYSNHSALESLALIPLQAPLKT (23aa)
- KNLTNIDISKN (11aa)
- KIDSTGNVTNELRV (14aa)
- KNFTENDLLVRI (12aa)
- KRNYIVPILWLNETGTIGDEKA (22aa)
- KAQYEGRLSLLEEPGNGTFTVILNQLTSRD (30aa)
- RLSLLEEPGNGTFTVILNQLTSRD (24aa)
- RVFHIHNESWVLLTPKA (17aa)
- KCGLVPVLAENYNKS (15aa)
- KCGLVPVLAENYNKSDNCEDTPEAGYFAIAVVKK (34aa)
- KSTGKPTLYNVSLVMSDTAGTCY- (24aa)
- KALPQPQNVTSLLGCTH- (18aa)
- KAPQHVVNHLPPYTNVSLKM (20aa)
- KVPGNVTAVLGETLKV (16aa)
- KIIEGEPNLKVPGNVTAVLGETLKV (25aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- KSCHTAVDRTAGWNIPMGLLFNQTGSCKF (29aa)
- KYWCKWNNTGCQALPSQDEGPSKA (24aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
- KYQGICPPVTRNETHFDAGAKF (22aa)
- RLHNQLLPNVTTVERN (16aa)
- KRHEEGHMLNCTCFGQGRG (19aa)
- KAAIPSALDTNSSKS (15aa)
- RNSTLDPGKPEMMKS (15aa)
- KSPTNTTPHVPAEGPEASRPPKL (23aa)
- RQQQHLFGSNVTDCSGNFCLFRS (23aa)
- KFGRNGSDCPDKF (13aa)
- RNGSDCPDKF (10aa)
- RNGSDCPDKFCLFQSETKN (19aa)
- KELHHLQEQNVSNAFLDKG (19aa)
- KIPCSQPPQIEHGTINSSRS (20aa)
- RLNYSLPTGQWVGVQLPRN (19aa)
- KFDRYRLNYSLPTGQWVGVQLPRN (24aa)
- KMDGASNVTCINSRW (15aa)
- KVVNSTTGPGEHLRN (15aa)
- RLNWTAADQAYEHFIIQVQEANKV (24aa)
- KVEAARNLTVPGSLRA (16aa)
- RHNLTVPGSLRAS (13aa)
- KTAHCNESFYFLCKR (15aa)
- RGLNVTLSSTGRN (13aa)
- RLNWTAADNAYEHFVIQVQEVNKV (24aa)
- KNTTCQDLQIEVTVKG (16aa)
- KVEAAQNLTLPGSLRA (16aa)
- RLLETVEYNISGAERT (16aa)
- RFNSSYLQGTNQITGRY (17aa)
- KRNDQLPSNFTPVFYSQLQKN (21aa)
- RTLHSTFQPNISQGKL (16aa)
- RTVVCHCNAESQCLYNQTSRV (21aa)
- RDVTALNVSTLKA (13aa)
- KTIHDLHLFIENIDFNKS (18aa)
- RVNQNLVYESGSLNFSKL (18aa)
- KFVEGSHNSTVSLTTKN (17aa)
- KYDFNSSMLYSTAKG (15aa)
Mass spectrometry observed peptide
-
- Free / Lactosamine
(avg mass : 383.3527)
- Milk (UBERON_0001913)
-
- Free / Lactosamine
(avg mass : 383.3527)
- Milk (UBERON_0001913)
-
- Free / Lactosamine
(avg mass : 674.6106)
- Milk (UBERON_0001913)
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Reviewed
- Annotation and Structural Analysis of Sialylated Human Milk Oligosaccharides (2011 - Shuai Wu, Rudolf Grimm, J Bruce German, Carlito B Lebrilla) / Status : Reviewed
-
- Free / Lactosamine
(avg mass : 674.6106)
- Milk (UBERON_0001913)
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Reviewed
- Annotation and Structural Analysis of Sialylated Human Milk Oligosaccharides (2011 - Shuai Wu, Rudolf Grimm, J Bruce German, Carlito B Lebrilla) / Status : Reviewed
-
- Free / Lactosamine
(avg mass : 820.7536)
- Milk (UBERON_0001913)
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
- Annotation and Structural Analysis of Sialylated Human Milk Oligosaccharides (2011 - Shuai Wu, Rudolf Grimm, J Bruce German, Carlito B Lebrilla) / Status : Reviewed
- Occurrence of tetra- and pentasaccharides with the sialyl-Le(a) structure in human milk. (1990 - Kitagawa H, Nakada H, Numata Y, Kurosaka A, Fukui S, Funakoshi I, Kawasaki T, Shimada I, Inagaki F, Yamashina I) / Status : Reviewed
-
- Free / Lactose
(avg mass : 342.3001)
- Milk (UBERON_0001913)
- Synthesis of Asymmetrical Multiantennary Human Milk Oligosaccharides (2017 - Anthony R Prudden, Lin Liu, Chantelle J Capicciotti, Margreet A Wolfert, Shuo Wang, Zhongwei Gao, Lu Meng, Kelley W Moremen, Geert-Jan Boons) / Status : Reviewed
- Chemical characterization of milk oligosaccharides of the polar bear, Ursus maritimus. (2000 - Urashima T, Yamashita T, Nakamura T, Arai I, Saito T, Derocher A, Wiig O) / Status : Reviewed
- Chemical characterization of milk oligosaccharides of the Japanese black bear, Ursus thibetanus japonicus. (1999 - Urashima T, Sumiyoshi W, Nakamura T, Arai I, Saito T, Komatsu T, Tsubota T) / Status : Reviewed
- Chemical characterisation of the oligosaccharides in a sample of milk of a white-nosed coati, Nasua narica (Procyonidae: Carnivora). (1999 - Urashima T, Yamamoto M, Nakamura T, Arai I, Saito T, Namiki M, Yamaoka K, Kawahara K) / Status : Reviewed
- Occurrence of an unusual lactose sulfate in dog milk. (1999 - Bubb W, Urashima T, Kohso K, Nakamura T, Arai I, Saito T) / Status : Reviewed
-
- Free / Lactose
(avg mass : 422.3643)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 488.4431)
- Milk (UBERON_0001913)
- Impact of maternal characteristics on human milk oligosaccharide composition over the first 4 months of lactation in a cohort of healthy European mothers (2019 - Tinu Mary Samuel, Aristea Binia, Carlos Antonio de Castro, Sagar K. Thakkar, Claude Billeaud, Massimo Agosti, Isam Al-Jashi, Maria Jose Costeira, Giovanna Marchini, Cecilia Martínez-Costa, Jean-Charles Picaud, Tom Stiris, Silvia-Maria Stoicescu, Mireille Vanpeé, Magnus Domellöf, Sean Austin & Norbert Sprenger) / Status : Reviewed
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Reviewed
- Synthesis of Asymmetrical Multiantennary Human Milk Oligosaccharides (2017 - Anthony R Prudden, Lin Liu, Chantelle J Capicciotti, Margreet A Wolfert, Shuo Wang, Zhongwei Gao, Lu Meng, Kelley W Moremen, Geert-Jan Boons) / Status : Reviewed
- Systematic Review of the Concentrations of Oligosaccharides in Human Milk (2017 - Stephan Thurl, Manfred Munzert, Günther Boehm, Catherine Matthews, Bernd Stahl) / Status : Reviewed
- Human Milk Oligosaccharides (HMOS): Structure, Function, and Enzyme-Catalyzed Synthesis (2015 - Xi Chen) / Status : Reviewed
- Annotation and Structural Analysis of Sialylated Human Milk Oligosaccharides (2011 - Shuai Wu, Rudolf Grimm, J Bruce German, Carlito B Lebrilla) / Status : Reviewed
- Development of an Annotated Library of Neutral Human Milk Oligosaccharides (2010 - Shuai Wu, Nannan Tao, J Bruce German, Rudolf Grimm, Carlito B Lebrilla) / Status : Reviewed
- Fucosylated human milk oligosaccharides vary between individuals and over the course of lactation (2001 - Chaturvedi, Warren, Altaye, Morrow, Ruiz-Palacios, Pickering, Newburg) / Status : Reviewed
- Comparison of oligosaccharides in milk specimens from humans and twelve other species. (2001 - Warren CD, Chaturvedi P, Newburg AR, Oftedal OT, Tilden CD, Newburg DS) / Status : Reviewed
- Chemical characterization of milk oligosaccharides of the polar bear, Ursus maritimus. (2000 - Urashima T, Yamashita T, Nakamura T, Arai I, Saito T, Derocher A, Wiig O) / Status : Reviewed
- Chemical characterization of milk oligosaccharides of the Japanese black bear, Ursus thibetanus japonicus. (1999 - Urashima T, Sumiyoshi W, Nakamura T, Arai I, Saito T, Komatsu T, Tsubota T) / Status : Reviewed
- Chemical characterisation of the oligosaccharides in a sample of milk of a white-nosed coati, Nasua narica (Procyonidae: Carnivora). (1999 - Urashima T, Yamamoto M, Nakamura T, Arai I, Saito T, Namiki M, Yamaoka K, Kawahara K) / Status : Reviewed
- Occurrence of an unusual lactose sulfate in dog milk. (1999 - Bubb W, Urashima T, Kohso K, Nakamura T, Arai I, Saito T) / Status : Reviewed
- Chemical characterization of milk oligosaccharides of the brown bear, Ursus arctos yesoensis. (1997 - Urashima T, Kusaka Y, Nakamura T, Saito T, Maeda N, Messer M) / Status : Reviewed
-
- Free / Lactose
(avg mass : 488.4431)
- Milk (UBERON_0001913)
- Impact of maternal characteristics on human milk oligosaccharide composition over the first 4 months of lactation in a cohort of healthy European mothers (2019 - Tinu Mary Samuel, Aristea Binia, Carlos Antonio de Castro, Sagar K. Thakkar, Claude Billeaud, Massimo Agosti, Isam Al-Jashi, Maria Jose Costeira, Giovanna Marchini, Cecilia Martínez-Costa, Jean-Charles Picaud, Tom Stiris, Silvia-Maria Stoicescu, Mireille Vanpeé, Magnus Domellöf, Sean Austin & Norbert Sprenger) / Status : Reviewed
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Reviewed
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
- Synthesis of Asymmetrical Multiantennary Human Milk Oligosaccharides (2017 - Anthony R Prudden, Lin Liu, Chantelle J Capicciotti, Margreet A Wolfert, Shuo Wang, Zhongwei Gao, Lu Meng, Kelley W Moremen, Geert-Jan Boons) / Status : Reviewed
- Systematic Review of the Concentrations of Oligosaccharides in Human Milk (2017 - Stephan Thurl, Manfred Munzert, Günther Boehm, Catherine Matthews, Bernd Stahl) / Status : Reviewed
- Human Milk Oligosaccharides (HMOS): Structure, Function, and Enzyme-Catalyzed Synthesis (2015 - Xi Chen) / Status : Reviewed
- Annotation and Structural Analysis of Sialylated Human Milk Oligosaccharides (2011 - Shuai Wu, Rudolf Grimm, J Bruce German, Carlito B Lebrilla) / Status : Reviewed
- Development of an Annotated Library of Neutral Human Milk Oligosaccharides (2010 - Shuai Wu, Nannan Tao, J Bruce German, Rudolf Grimm, Carlito B Lebrilla) / Status : Reviewed
- Fucosylated human milk oligosaccharides vary between individuals and over the course of lactation (2001 - Chaturvedi, Warren, Altaye, Morrow, Ruiz-Palacios, Pickering, Newburg) / Status : Reviewed
- Comparison of oligosaccharides in milk specimens from humans and twelve other species. (2001 - Warren CD, Chaturvedi P, Newburg AR, Oftedal OT, Tilden CD, Newburg DS) / Status : Reviewed
-
- Free / Lactose
(avg mass : 504.4425)
- Milk (UBERON_0001913)
- Chemical characterization of milk oligosaccharides of the polar bear, Ursus maritimus. (2000 - Urashima T, Yamashita T, Nakamura T, Arai I, Saito T, Derocher A, Wiig O) / Status : Reviewed
- Chemical characterization of milk oligosaccharides of the Japanese black bear, Ursus thibetanus japonicus. (1999 - Urashima T, Sumiyoshi W, Nakamura T, Arai I, Saito T, Komatsu T, Tsubota T) / Status : Reviewed
- Chemical characterisation of the oligosaccharides in a sample of milk of a white-nosed coati, Nasua narica (Procyonidae: Carnivora). (1999 - Urashima T, Yamamoto M, Nakamura T, Arai I, Saito T, Namiki M, Yamaoka K, Kawahara K) / Status : Reviewed
- Chemical characterization of milk oligosaccharides of the brown bear, Ursus arctos yesoensis. (1997 - Urashima T, Kusaka Y, Nakamura T, Saito T, Maeda N, Messer M) / Status : Reviewed
-
- Free / Lactose
(avg mass : 504.4425)
- Milk (UBERON_0001913)
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Reviewed
- Structure of a marsupial-mild trisaccharide. (1980 - Messer M, Trifonoff E, Stern W, Collins J, Bradbury J) / Status : Reviewed
-
- Free / Lactose
(avg mass : 504.4425)
- Milk (UBERON_0001913)
- Impact of maternal characteristics on human milk oligosaccharide composition over the first 4 months of lactation in a cohort of healthy European mothers (2019 - Tinu Mary Samuel, Aristea Binia, Carlos Antonio de Castro, Sagar K. Thakkar, Claude Billeaud, Massimo Agosti, Isam Al-Jashi, Maria Jose Costeira, Giovanna Marchini, Cecilia Martínez-Costa, Jean-Charles Picaud, Tom Stiris, Silvia-Maria Stoicescu, Mireille Vanpeé, Magnus Domellöf, Sean Austin & Norbert Sprenger) / Status : Reviewed
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
-
- Free / Lactose
(avg mass : 504.4425)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 504.4425)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 545.4951)
- Milk (UBERON_0001913)
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
- Human Milk Oligosaccharides (HMOS): Structure, Function, and Enzyme-Catalyzed Synthesis (2015 - Xi Chen) / Status : Reviewed
-
- Free / Lactose
(avg mass : 633.558)
- Milk (UBERON_0001913)
- Impact of maternal characteristics on human milk oligosaccharide composition over the first 4 months of lactation in a cohort of healthy European mothers (2019 - Tinu Mary Samuel, Aristea Binia, Carlos Antonio de Castro, Sagar K. Thakkar, Claude Billeaud, Massimo Agosti, Isam Al-Jashi, Maria Jose Costeira, Giovanna Marchini, Cecilia Martínez-Costa, Jean-Charles Picaud, Tom Stiris, Silvia-Maria Stoicescu, Mireille Vanpeé, Magnus Domellöf, Sean Austin & Norbert Sprenger) / Status : Reviewed
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Reviewed
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
- Synthesis of Asymmetrical Multiantennary Human Milk Oligosaccharides (2017 - Anthony R Prudden, Lin Liu, Chantelle J Capicciotti, Margreet A Wolfert, Shuo Wang, Zhongwei Gao, Lu Meng, Kelley W Moremen, Geert-Jan Boons) / Status : Reviewed
- Systematic Review of the Concentrations of Oligosaccharides in Human Milk (2017 - Stephan Thurl, Manfred Munzert, Günther Boehm, Catherine Matthews, Bernd Stahl) / Status : Reviewed
- Human Milk Oligosaccharides (HMOS): Structure, Function, and Enzyme-Catalyzed Synthesis (2015 - Xi Chen) / Status : Reviewed
- Annotation and Structural Analysis of Sialylated Human Milk Oligosaccharides (2011 - Shuai Wu, Rudolf Grimm, J Bruce German, Carlito B Lebrilla) / Status : Reviewed
- High-performance capillary electrophoresis of sialylated oligosaccharides of human milk. (2000 - Shen Z, Warren C, Newburg D) / Status : Reviewed
- Fractionation of sialyl oligosaccharides of human milk by ion-exchange chromatography (1978 - David F. Smith, David A. Zorf, Victor Ginsburg) / Status : Reviewed
-
- Free / Lactose
(avg mass : 633.558)
- Milk (UBERON_0001913)
- Impact of maternal characteristics on human milk oligosaccharide composition over the first 4 months of lactation in a cohort of healthy European mothers (2019 - Tinu Mary Samuel, Aristea Binia, Carlos Antonio de Castro, Sagar K. Thakkar, Claude Billeaud, Massimo Agosti, Isam Al-Jashi, Maria Jose Costeira, Giovanna Marchini, Cecilia Martínez-Costa, Jean-Charles Picaud, Tom Stiris, Silvia-Maria Stoicescu, Mireille Vanpeé, Magnus Domellöf, Sean Austin & Norbert Sprenger) / Status : Reviewed
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Reviewed
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
- Synthesis of Asymmetrical Multiantennary Human Milk Oligosaccharides (2017 - Anthony R Prudden, Lin Liu, Chantelle J Capicciotti, Margreet A Wolfert, Shuo Wang, Zhongwei Gao, Lu Meng, Kelley W Moremen, Geert-Jan Boons) / Status : Reviewed
- Systematic Review of the Concentrations of Oligosaccharides in Human Milk (2017 - Stephan Thurl, Manfred Munzert, Günther Boehm, Catherine Matthews, Bernd Stahl) / Status : Reviewed
- Human Milk Oligosaccharides (HMOS): Structure, Function, and Enzyme-Catalyzed Synthesis (2015 - Xi Chen) / Status : Reviewed
- Annotation and Structural Analysis of Sialylated Human Milk Oligosaccharides (2011 - Shuai Wu, Rudolf Grimm, J Bruce German, Carlito B Lebrilla) / Status : Reviewed
- High-performance capillary electrophoresis of sialylated oligosaccharides of human milk. (2000 - Shen Z, Warren C, Newburg D) / Status : Reviewed
- Fractionation of sialyl oligosaccharides of human milk by ion-exchange chromatography (1978 - David F. Smith, David A. Zorf, Victor Ginsburg) / Status : Reviewed
-
- Free / Lactose
(avg mass : 634.5861)
- Milk (UBERON_0001913)
- Impact of maternal characteristics on human milk oligosaccharide composition over the first 4 months of lactation in a cohort of healthy European mothers (2019 - Tinu Mary Samuel, Aristea Binia, Carlos Antonio de Castro, Sagar K. Thakkar, Claude Billeaud, Massimo Agosti, Isam Al-Jashi, Maria Jose Costeira, Giovanna Marchini, Cecilia Martínez-Costa, Jean-Charles Picaud, Tom Stiris, Silvia-Maria Stoicescu, Mireille Vanpeé, Magnus Domellöf, Sean Austin & Norbert Sprenger) / Status : Reviewed
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Reviewed
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
- Synthesis of Asymmetrical Multiantennary Human Milk Oligosaccharides (2017 - Anthony R Prudden, Lin Liu, Chantelle J Capicciotti, Margreet A Wolfert, Shuo Wang, Zhongwei Gao, Lu Meng, Kelley W Moremen, Geert-Jan Boons) / Status : Reviewed
- Systematic Review of the Concentrations of Oligosaccharides in Human Milk (2017 - Stephan Thurl, Manfred Munzert, Günther Boehm, Catherine Matthews, Bernd Stahl) / Status : Reviewed
- Human Milk Oligosaccharides (HMOS): Structure, Function, and Enzyme-Catalyzed Synthesis (2015 - Xi Chen) / Status : Reviewed
- Development of an Annotated Library of Neutral Human Milk Oligosaccharides (2010 - Shuai Wu, Nannan Tao, J Bruce German, Rudolf Grimm, Carlito B Lebrilla) / Status : Reviewed
- Fucosylated human milk oligosaccharides vary between individuals and over the course of lactation (2001 - Chaturvedi, Warren, Altaye, Morrow, Ruiz-Palacios, Pickering, Newburg) / Status : Reviewed
- Comparison of oligosaccharides in milk specimens from humans and twelve other species. (2001 - Warren CD, Chaturvedi P, Newburg AR, Oftedal OT, Tilden CD, Newburg DS) / Status : Reviewed
-
- Free / Lactose
(avg mass : 650.5855)
- Milk (UBERON_0001913)
- Chemical characterization of milk oligosaccharides of the polar bear, Ursus maritimus. (2000 - Urashima T, Yamashita T, Nakamura T, Arai I, Saito T, Derocher A, Wiig O) / Status : Reviewed
- Chemical characterization of milk oligosaccharides of the Japanese black bear, Ursus thibetanus japonicus. (1999 - Urashima T, Sumiyoshi W, Nakamura T, Arai I, Saito T, Komatsu T, Tsubota T) / Status : Reviewed
-
- Free / Lactose
(avg mass : 650.5855)
- Milk (UBERON_0001913)
- Chemical characterization of milk oligosaccharides of the polar bear, Ursus maritimus. (2000 - Urashima T, Yamashita T, Nakamura T, Arai I, Saito T, Derocher A, Wiig O) / Status : Reviewed
- Chemical characterization of milk oligosaccharides of the Japanese black bear, Ursus thibetanus japonicus. (1999 - Urashima T, Sumiyoshi W, Nakamura T, Arai I, Saito T, Komatsu T, Tsubota T) / Status : Reviewed
-
- Free / Lactose
(avg mass : 675.5947)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 691.6381)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 707.6375)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 707.6375)
- Milk (UBERON_0001913)
- Impact of maternal characteristics on human milk oligosaccharide composition over the first 4 months of lactation in a cohort of healthy European mothers (2019 - Tinu Mary Samuel, Aristea Binia, Carlos Antonio de Castro, Sagar K. Thakkar, Claude Billeaud, Massimo Agosti, Isam Al-Jashi, Maria Jose Costeira, Giovanna Marchini, Cecilia Martínez-Costa, Jean-Charles Picaud, Tom Stiris, Silvia-Maria Stoicescu, Mireille Vanpeé, Magnus Domellöf, Sean Austin & Norbert Sprenger) / Status : Reviewed
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Reviewed
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
- Systematic Review of the Concentrations of Oligosaccharides in Human Milk (2017 - Stephan Thurl, Manfred Munzert, Günther Boehm, Catherine Matthews, Bernd Stahl) / Status : Reviewed
- Human Milk Oligosaccharides (HMOS): Structure, Function, and Enzyme-Catalyzed Synthesis (2015 - Xi Chen) / Status : Reviewed
- Development of an Annotated Library of Neutral Human Milk Oligosaccharides (2010 - Shuai Wu, Nannan Tao, J Bruce German, Rudolf Grimm, Carlito B Lebrilla) / Status : Reviewed
- Fucosylated human milk oligosaccharides vary between individuals and over the course of lactation (2001 - Chaturvedi, Warren, Altaye, Morrow, Ruiz-Palacios, Pickering, Newburg) / Status : Reviewed
- Comparison of oligosaccharides in milk specimens from humans and twelve other species. (2001 - Warren CD, Chaturvedi P, Newburg AR, Oftedal OT, Tilden CD, Newburg DS) / Status : Reviewed
- Fractionation of sialyl oligosaccharides of human milk by ion-exchange chromatography (1978 - David F. Smith, David A. Zorf, Victor Ginsburg) / Status : Reviewed
- Oligosaccharides of human milk: Structural studies of Di- and trifucosyl derivatives of lacto-N-octaose and lacto-N-neooctaose (1978 - Yoko Tachibana, Katsuko Yamashita, Akira Kobata) / Status : Reviewed
-
- Free / Lactose
(avg mass : 707.6375)
- Milk (UBERON_0001913)
- Impact of maternal characteristics on human milk oligosaccharide composition over the first 4 months of lactation in a cohort of healthy European mothers (2019 - Tinu Mary Samuel, Aristea Binia, Carlos Antonio de Castro, Sagar K. Thakkar, Claude Billeaud, Massimo Agosti, Isam Al-Jashi, Maria Jose Costeira, Giovanna Marchini, Cecilia Martínez-Costa, Jean-Charles Picaud, Tom Stiris, Silvia-Maria Stoicescu, Mireille Vanpeé, Magnus Domellöf, Sean Austin & Norbert Sprenger) / Status : Reviewed
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Reviewed
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
- Synthesis of Asymmetrical Multiantennary Human Milk Oligosaccharides (2017 - Anthony R Prudden, Lin Liu, Chantelle J Capicciotti, Margreet A Wolfert, Shuo Wang, Zhongwei Gao, Lu Meng, Kelley W Moremen, Geert-Jan Boons) / Status : Reviewed
- Systematic Review of the Concentrations of Oligosaccharides in Human Milk (2017 - Stephan Thurl, Manfred Munzert, Günther Boehm, Catherine Matthews, Bernd Stahl) / Status : Reviewed
- Human Milk Oligosaccharides (HMOS): Structure, Function, and Enzyme-Catalyzed Synthesis (2015 - Xi Chen) / Status : Reviewed
- Development of an Annotated Library of Neutral Human Milk Oligosaccharides (2010 - Shuai Wu, Nannan Tao, J Bruce German, Rudolf Grimm, Carlito B Lebrilla) / Status : Reviewed
- Fucosylated human milk oligosaccharides vary between individuals and over the course of lactation (2001 - Chaturvedi, Warren, Altaye, Morrow, Ruiz-Palacios, Pickering, Newburg) / Status : Reviewed
- Comparison of oligosaccharides in milk specimens from humans and twelve other species. (2001 - Warren CD, Chaturvedi P, Newburg AR, Oftedal OT, Tilden CD, Newburg DS) / Status : Reviewed
- Chemical characterisation of the oligosaccharides in a sample of milk of a white-nosed coati, Nasua narica (Procyonidae: Carnivora). (1999 - Urashima T, Yamamoto M, Nakamura T, Arai I, Saito T, Namiki M, Yamaoka K, Kawahara K) / Status : Reviewed
- Fractionation of sialyl oligosaccharides of human milk by ion-exchange chromatography (1978 - David F. Smith, David A. Zorf, Victor Ginsburg) / Status : Reviewed
-
- Free / Lactose
(avg mass : 713.6222)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 779.701)
- Milk (UBERON_0001913)
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Reviewed
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
- Synthesis of Asymmetrical Multiantennary Human Milk Oligosaccharides (2017 - Anthony R Prudden, Lin Liu, Chantelle J Capicciotti, Margreet A Wolfert, Shuo Wang, Zhongwei Gao, Lu Meng, Kelley W Moremen, Geert-Jan Boons) / Status : Reviewed
- Human Milk Oligosaccharides (HMOS): Structure, Function, and Enzyme-Catalyzed Synthesis (2015 - Xi Chen) / Status : Reviewed
- High-performance capillary electrophoresis of sialylated oligosaccharides of human milk. (2000 - Shen Z, Warren C, Newburg D) / Status : Reviewed
-
- Free / Lactose
(avg mass : 796.7285)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 828.7273)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 837.7811)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 837.7811)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 853.7805)
- Milk (UBERON_0001913)
- Impact of maternal characteristics on human milk oligosaccharide composition over the first 4 months of lactation in a cohort of healthy European mothers (2019 - Tinu Mary Samuel, Aristea Binia, Carlos Antonio de Castro, Sagar K. Thakkar, Claude Billeaud, Massimo Agosti, Isam Al-Jashi, Maria Jose Costeira, Giovanna Marchini, Cecilia Martínez-Costa, Jean-Charles Picaud, Tom Stiris, Silvia-Maria Stoicescu, Mireille Vanpeé, Magnus Domellöf, Sean Austin & Norbert Sprenger) / Status : Reviewed
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Reviewed
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
- Systematic Review of the Concentrations of Oligosaccharides in Human Milk (2017 - Stephan Thurl, Manfred Munzert, Günther Boehm, Catherine Matthews, Bernd Stahl) / Status : Reviewed
- Human Milk Oligosaccharides (HMOS): Structure, Function, and Enzyme-Catalyzed Synthesis (2015 - Xi Chen) / Status : Reviewed
- Development of an Annotated Library of Neutral Human Milk Oligosaccharides (2010 - Shuai Wu, Nannan Tao, J Bruce German, Rudolf Grimm, Carlito B Lebrilla) / Status : Reviewed
- Fucosylated human milk oligosaccharides vary between individuals and over the course of lactation (2001 - Chaturvedi, Warren, Altaye, Morrow, Ruiz-Palacios, Pickering, Newburg) / Status : Reviewed
- Comparison of oligosaccharides in milk specimens from humans and twelve other species. (2001 - Warren CD, Chaturvedi P, Newburg AR, Oftedal OT, Tilden CD, Newburg DS) / Status : Reviewed
-
- Free / Lactose
(avg mass : 853.7805)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 853.7805)
- Milk (UBERON_0001913)
- Impact of maternal characteristics on human milk oligosaccharide composition over the first 4 months of lactation in a cohort of healthy European mothers (2019 - Tinu Mary Samuel, Aristea Binia, Carlos Antonio de Castro, Sagar K. Thakkar, Claude Billeaud, Massimo Agosti, Isam Al-Jashi, Maria Jose Costeira, Giovanna Marchini, Cecilia Martínez-Costa, Jean-Charles Picaud, Tom Stiris, Silvia-Maria Stoicescu, Mireille Vanpeé, Magnus Domellöf, Sean Austin & Norbert Sprenger) / Status : Reviewed
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Reviewed
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
- Systematic Review of the Concentrations of Oligosaccharides in Human Milk (2017 - Stephan Thurl, Manfred Munzert, Günther Boehm, Catherine Matthews, Bernd Stahl) / Status : Reviewed
- Human Milk Oligosaccharides (HMOS): Structure, Function, and Enzyme-Catalyzed Synthesis (2015 - Xi Chen) / Status : Reviewed
- Development of an Annotated Library of Neutral Human Milk Oligosaccharides (2010 - Shuai Wu, Nannan Tao, J Bruce German, Rudolf Grimm, Carlito B Lebrilla) / Status : Reviewed
- Oligosaccharides of human milk: Structural studies of Di- and trifucosyl derivatives of lacto-N-octaose and lacto-N-neooctaose (1978 - Yoko Tachibana, Katsuko Yamashita, Akira Kobata) / Status : Reviewed
-
- Free / Lactose
(avg mass : 853.7805)
- Milk (UBERON_0001913)
- Fucosylated human milk oligosaccharides vary between individuals and over the course of lactation (2001 - Chaturvedi, Warren, Altaye, Morrow, Ruiz-Palacios, Pickering, Newburg) / Status : Reviewed
- Comparison of oligosaccharides in milk specimens from humans and twelve other species. (2001 - Warren CD, Chaturvedi P, Newburg AR, Oftedal OT, Tilden CD, Newburg DS) / Status : Reviewed
-
- Free / Lactose
(avg mass : 853.7805)
- Milk (UBERON_0001913)
- Impact of maternal characteristics on human milk oligosaccharide composition over the first 4 months of lactation in a cohort of healthy European mothers (2019 - Tinu Mary Samuel, Aristea Binia, Carlos Antonio de Castro, Sagar K. Thakkar, Claude Billeaud, Massimo Agosti, Isam Al-Jashi, Maria Jose Costeira, Giovanna Marchini, Cecilia Martínez-Costa, Jean-Charles Picaud, Tom Stiris, Silvia-Maria Stoicescu, Mireille Vanpeé, Magnus Domellöf, Sean Austin & Norbert Sprenger) / Status : Reviewed
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Reviewed
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
- Systematic Review of the Concentrations of Oligosaccharides in Human Milk (2017 - Stephan Thurl, Manfred Munzert, Günther Boehm, Catherine Matthews, Bernd Stahl) / Status : Reviewed
- Human Milk Oligosaccharides (HMOS): Structure, Function, and Enzyme-Catalyzed Synthesis (2015 - Xi Chen) / Status : Reviewed
-
- Free / Lactose
(avg mass : 853.7805)
- Milk (UBERON_0001913)
- Impact of maternal characteristics on human milk oligosaccharide composition over the first 4 months of lactation in a cohort of healthy European mothers (2019 - Tinu Mary Samuel, Aristea Binia, Carlos Antonio de Castro, Sagar K. Thakkar, Claude Billeaud, Massimo Agosti, Isam Al-Jashi, Maria Jose Costeira, Giovanna Marchini, Cecilia Martínez-Costa, Jean-Charles Picaud, Tom Stiris, Silvia-Maria Stoicescu, Mireille Vanpeé, Magnus Domellöf, Sean Austin & Norbert Sprenger) / Status : Reviewed
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Reviewed
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
- Synthesis of Asymmetrical Multiantennary Human Milk Oligosaccharides (2017 - Anthony R Prudden, Lin Liu, Chantelle J Capicciotti, Margreet A Wolfert, Shuo Wang, Zhongwei Gao, Lu Meng, Kelley W Moremen, Geert-Jan Boons) / Status : Reviewed
- Systematic Review of the Concentrations of Oligosaccharides in Human Milk (2017 - Stephan Thurl, Manfred Munzert, Günther Boehm, Catherine Matthews, Bernd Stahl) / Status : Reviewed
- Human Milk Oligosaccharides (HMOS): Structure, Function, and Enzyme-Catalyzed Synthesis (2015 - Xi Chen) / Status : Reviewed
- Development of an Annotated Library of Neutral Human Milk Oligosaccharides (2010 - Shuai Wu, Nannan Tao, J Bruce German, Rudolf Grimm, Carlito B Lebrilla) / Status : Reviewed
-
- Free / Lactose
(avg mass : 853.7805)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 853.7805)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 853.7805)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 869.7799)
- Milk (UBERON_0001913)
- Chemical characterization of milk oligosaccharides of the polar bear, Ursus maritimus. (2000 - Urashima T, Yamashita T, Nakamura T, Arai I, Saito T, Derocher A, Wiig O) / Status : Reviewed
- Chemical characterisation of the oligosaccharides in a sample of milk of a white-nosed coati, Nasua narica (Procyonidae: Carnivora). (1999 - Urashima T, Yamamoto M, Nakamura T, Arai I, Saito T, Namiki M, Yamaoka K, Kawahara K) / Status : Reviewed
-
- Free / Lactose
(avg mass : 869.7799)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 869.7799)
- Milk (UBERON_0001913)
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Reviewed
- 13C-N.m.r. study of the structures of two branched oligosaccharides from marsupial milk. (1983 - Bradbury J, Collins J, Jenkins G, Trifonoff E, Messer M) / Status : Reviewed
-
- Free / Lactose
(avg mass : 910.8325)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 910.8325)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 910.8325)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 998.8954)
- Milk (UBERON_0001913)
- Impact of maternal characteristics on human milk oligosaccharide composition over the first 4 months of lactation in a cohort of healthy European mothers (2019 - Tinu Mary Samuel, Aristea Binia, Carlos Antonio de Castro, Sagar K. Thakkar, Claude Billeaud, Massimo Agosti, Isam Al-Jashi, Maria Jose Costeira, Giovanna Marchini, Cecilia Martínez-Costa, Jean-Charles Picaud, Tom Stiris, Silvia-Maria Stoicescu, Mireille Vanpeé, Magnus Domellöf, Sean Austin & Norbert Sprenger) / Status : Reviewed
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Reviewed
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
- Systematic Review of the Concentrations of Oligosaccharides in Human Milk (2017 - Stephan Thurl, Manfred Munzert, Günther Boehm, Catherine Matthews, Bernd Stahl) / Status : Reviewed
- Human Milk Oligosaccharides (HMOS): Structure, Function, and Enzyme-Catalyzed Synthesis (2015 - Xi Chen) / Status : Reviewed
- Annotation and Structural Analysis of Sialylated Human Milk Oligosaccharides (2011 - Shuai Wu, Rudolf Grimm, J Bruce German, Carlito B Lebrilla) / Status : Reviewed
- Fractionation of sialyl oligosaccharides of human milk by ion-exchange chromatography (1978 - David F. Smith, David A. Zorf, Victor Ginsburg) / Status : Reviewed
-
- Free / Lactose
(avg mass : 998.8954)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 998.8954)
- Milk (UBERON_0001913)
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Reviewed
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
- Systematic Review of the Concentrations of Oligosaccharides in Human Milk (2017 - Stephan Thurl, Manfred Munzert, Günther Boehm, Catherine Matthews, Bernd Stahl) / Status : Reviewed
- Human Milk Oligosaccharides (HMOS): Structure, Function, and Enzyme-Catalyzed Synthesis (2015 - Xi Chen) / Status : Reviewed
- Annotation and Structural Analysis of Sialylated Human Milk Oligosaccharides (2011 - Shuai Wu, Rudolf Grimm, J Bruce German, Carlito B Lebrilla) / Status : Reviewed
- High-performance capillary electrophoresis of sialylated oligosaccharides of human milk. (2000 - Shen Z, Warren C, Newburg D) / Status : Reviewed
- Fractionation of sialyl oligosaccharides of human milk by ion-exchange chromatography (1978 - David F. Smith, David A. Zorf, Victor Ginsburg) / Status : Reviewed
-
- Free / Lactose
(avg mass : 998.8954)
- Milk (UBERON_0001913)
- Impact of maternal characteristics on human milk oligosaccharide composition over the first 4 months of lactation in a cohort of healthy European mothers (2019 - Tinu Mary Samuel, Aristea Binia, Carlos Antonio de Castro, Sagar K. Thakkar, Claude Billeaud, Massimo Agosti, Isam Al-Jashi, Maria Jose Costeira, Giovanna Marchini, Cecilia Martínez-Costa, Jean-Charles Picaud, Tom Stiris, Silvia-Maria Stoicescu, Mireille Vanpeé, Magnus Domellöf, Sean Austin & Norbert Sprenger) / Status : Reviewed
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Reviewed
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
- Synthesis of Asymmetrical Multiantennary Human Milk Oligosaccharides (2017 - Anthony R Prudden, Lin Liu, Chantelle J Capicciotti, Margreet A Wolfert, Shuo Wang, Zhongwei Gao, Lu Meng, Kelley W Moremen, Geert-Jan Boons) / Status : Reviewed
- Systematic Review of the Concentrations of Oligosaccharides in Human Milk (2017 - Stephan Thurl, Manfred Munzert, Günther Boehm, Catherine Matthews, Bernd Stahl) / Status : Reviewed
- Human Milk Oligosaccharides (HMOS): Structure, Function, and Enzyme-Catalyzed Synthesis (2015 - Xi Chen) / Status : Reviewed
- Annotation and Structural Analysis of Sialylated Human Milk Oligosaccharides (2011 - Shuai Wu, Rudolf Grimm, J Bruce German, Carlito B Lebrilla) / Status : Reviewed
- High-performance capillary electrophoresis of sialylated oligosaccharides of human milk. (2000 - Shen Z, Warren C, Newburg D) / Status : Reviewed
- Fractionation of sialyl oligosaccharides of human milk by ion-exchange chromatography (1978 - David F. Smith, David A. Zorf, Victor Ginsburg) / Status : Reviewed
-
- Free / Lactose
(avg mass : 999.9235)
- Milk (UBERON_0001913)
- Impact of maternal characteristics on human milk oligosaccharide composition over the first 4 months of lactation in a cohort of healthy European mothers (2019 - Tinu Mary Samuel, Aristea Binia, Carlos Antonio de Castro, Sagar K. Thakkar, Claude Billeaud, Massimo Agosti, Isam Al-Jashi, Maria Jose Costeira, Giovanna Marchini, Cecilia Martínez-Costa, Jean-Charles Picaud, Tom Stiris, Silvia-Maria Stoicescu, Mireille Vanpeé, Magnus Domellöf, Sean Austin & Norbert Sprenger) / Status : Reviewed
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Reviewed
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
- Systematic Review of the Concentrations of Oligosaccharides in Human Milk (2017 - Stephan Thurl, Manfred Munzert, Günther Boehm, Catherine Matthews, Bernd Stahl) / Status : Reviewed
- Human Milk Oligosaccharides (HMOS): Structure, Function, and Enzyme-Catalyzed Synthesis (2015 - Xi Chen) / Status : Reviewed
- Development of an Annotated Library of Neutral Human Milk Oligosaccharides (2010 - Shuai Wu, Nannan Tao, J Bruce German, Rudolf Grimm, Carlito B Lebrilla) / Status : Reviewed
-
- Free / Lactose
(avg mass : 999.9235)
- Milk (UBERON_0001913)
- Fucosylated human milk oligosaccharides vary between individuals and over the course of lactation (2001 - Chaturvedi, Warren, Altaye, Morrow, Ruiz-Palacios, Pickering, Newburg) / Status : Reviewed
- Comparison of oligosaccharides in milk specimens from humans and twelve other species. (2001 - Warren CD, Chaturvedi P, Newburg AR, Oftedal OT, Tilden CD, Newburg DS) / Status : Reviewed
-
- Free / Lactose
(avg mass : 999.9235)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 999.9235)
- Milk (UBERON_0001913)
- Fucosylated human milk oligosaccharides vary between individuals and over the course of lactation (2001 - Chaturvedi, Warren, Altaye, Morrow, Ruiz-Palacios, Pickering, Newburg) / Status : Reviewed
- Comparison of oligosaccharides in milk specimens from humans and twelve other species. (2001 - Warren CD, Chaturvedi P, Newburg AR, Oftedal OT, Tilden CD, Newburg DS) / Status : Reviewed
-
- Free / Lactose
(avg mass : 999.9235)
- Milk (UBERON_0001913)
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Reviewed
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
- Systematic Review of the Concentrations of Oligosaccharides in Human Milk (2017 - Stephan Thurl, Manfred Munzert, Günther Boehm, Catherine Matthews, Bernd Stahl) / Status : Reviewed
- Human Milk Oligosaccharides (HMOS): Structure, Function, and Enzyme-Catalyzed Synthesis (2015 - Xi Chen) / Status : Reviewed
- Development of an Annotated Library of Neutral Human Milk Oligosaccharides (2010 - Shuai Wu, Nannan Tao, J Bruce German, Rudolf Grimm, Carlito B Lebrilla) / Status : Reviewed
-
- Free / Lactose
(avg mass : 999.9235)
- Milk (UBERON_0001913)
- Impact of maternal characteristics on human milk oligosaccharide composition over the first 4 months of lactation in a cohort of healthy European mothers (2019 - Tinu Mary Samuel, Aristea Binia, Carlos Antonio de Castro, Sagar K. Thakkar, Claude Billeaud, Massimo Agosti, Isam Al-Jashi, Maria Jose Costeira, Giovanna Marchini, Cecilia Martínez-Costa, Jean-Charles Picaud, Tom Stiris, Silvia-Maria Stoicescu, Mireille Vanpeé, Magnus Domellöf, Sean Austin & Norbert Sprenger) / Status : Reviewed
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
- Synthesis of Asymmetrical Multiantennary Human Milk Oligosaccharides (2017 - Anthony R Prudden, Lin Liu, Chantelle J Capicciotti, Margreet A Wolfert, Shuo Wang, Zhongwei Gao, Lu Meng, Kelley W Moremen, Geert-Jan Boons) / Status : Reviewed
- Human Milk Oligosaccharides (HMOS): Structure, Function, and Enzyme-Catalyzed Synthesis (2015 - Xi Chen) / Status : Reviewed
-
- Free / Lactose
(avg mass : 1015.9229)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 1015.9229)
- Milk (UBERON_0001913)
- Chemical characterization of milk oligosaccharides of the polar bear, Ursus maritimus. (2000 - Urashima T, Yamashita T, Nakamura T, Arai I, Saito T, Derocher A, Wiig O) / Status : Reviewed
- Chemical characterization of milk oligosaccharides of the Japanese black bear, Ursus thibetanus japonicus. (1999 - Urashima T, Sumiyoshi W, Nakamura T, Arai I, Saito T, Komatsu T, Tsubota T) / Status : Reviewed
- Chemical characterization of milk oligosaccharides of the brown bear, Ursus arctos yesoensis. (1997 - Urashima T, Kusaka Y, Nakamura T, Saito T, Maeda N, Messer M) / Status : Reviewed
-
- Free / Lactose
(avg mass : 1015.9229)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 1031.9223)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 1072.9749)
- Milk (UBERON_0001913)
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Reviewed
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
- Systematic Review of the Concentrations of Oligosaccharides in Human Milk (2017 - Stephan Thurl, Manfred Munzert, Günther Boehm, Catherine Matthews, Bernd Stahl) / Status : Reviewed
- Human Milk Oligosaccharides (HMOS): Structure, Function, and Enzyme-Catalyzed Synthesis (2015 - Xi Chen) / Status : Reviewed
- Development of an Annotated Library of Neutral Human Milk Oligosaccharides (2010 - Shuai Wu, Nannan Tao, J Bruce German, Rudolf Grimm, Carlito B Lebrilla) / Status : Reviewed
-
- Free / Lactose
(avg mass : 1072.9749)
- Milk (UBERON_0001913)
-
- Free / Lactose
(avg mass : 1072.9749)
- Milk (UBERON_0001913)
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Reviewed
- Human milk oligosaccharides as essential tools for basic and application studies on galectins (2018 - Tadasu Urashima, Jun Hirabayashi, Sachiko Sato, Akira Kobata) / Status : Reviewed
- Synthesis of Asymmetrical Multiantennary Human Milk Oligosaccharides (2017 - Anthony R Prudden, Lin Liu, Chantelle J Capicciotti, Margreet A Wolfert, Shuo Wang, Zhongwei Gao, Lu Meng, Kelley W Moremen, Geert-Jan Boons) / Status : Reviewed
- Systema
Source
Reference
- Free / Lactose
(avg mass : 1072.9749)
Source
Reported glycosite
- Free / Lactose
(avg mass : 1072.9749)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 1072.9749)
Source
Reported glycosite
- Free / Lactose
(avg mass : 1031.9223)
Source
Reported glycosite
- Free / Lactose
(avg mass : 1015.9229)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 1015.9229)
Source
Reported glycosite
- Free / Lactose
(avg mass : 1015.9229)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 999.9235)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 999.9235)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 999.9235)
Source
Reported glycosite
- Free / Lactose
(avg mass : 999.9235)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 999.9235)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 999.9235)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 998.8954)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 998.8954)
Source
Reported glycosite
- Free / Lactose
(avg mass : 998.8954)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 998.8954)
Source
Reported glycosite
- Free / Lactose
(avg mass : 910.8325)
Source
Reported glycosite
- Free / Lactose
(avg mass : 910.8325)
Source
Reported glycosite
- Free / Lactose
(avg mass : 910.8325)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 869.7799)
Source
Reported glycosite
- Free / Lactose
(avg mass : 869.7799)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 869.7799)
Source
Reported glycosite
- Free / Lactose
(avg mass : 853.7805)
Source
Reported glycosite
- Free / Lactose
(avg mass : 853.7805)
Source
Reported glycosite
- Free / Lactose
(avg mass : 853.7805)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 853.7805)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 853.7805)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 853.7805)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 853.7805)
Source
Reported glycosite
- Free / Lactose
(avg mass : 853.7805)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 853.7805)
Source
Reported glycosite
- Free / Lactose
(avg mass : 837.7811)
Source
Reported glycosite
- Free / Lactose
(avg mass : 837.7811)
Source
Reported glycosite
- Free / Lactose
(avg mass : 828.7273)
Source
Reported glycosite
- Free / Lactose
(avg mass : 796.7285)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 779.701)
Source
Reported glycosite
- Free / Lactose
(avg mass : 713.6222)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 707.6375)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 707.6375)
Source
Reported glycosite
- Free / Lactose
(avg mass : 707.6375)
Source
Reported glycosite
- Free / Lactose
(avg mass : 691.6381)
Source
Reported glycosite
- Free / Lactose
(avg mass : 675.5947)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 650.5855)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 650.5855)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 634.5861)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 633.558)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 633.558)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 545.4951)
Source
Reported glycosite
- Free / Lactose
(avg mass : 504.4425)
Source
Reported glycosite
- Free / Lactose
(avg mass : 504.4425)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 504.4425)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 504.4425)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 504.4425)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 488.4431)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 488.4431)
Source
Reported glycosite
- Free / Lactose
(avg mass : 422.3643)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 342.3001)
Source
Reference
Reported glycosite
- Free / Lactosamine
(avg mass : 820.7536)
Source
Reference
Reported glycosite
- Free / Lactosamine
(avg mass : 674.6106)
Source
Reference
Reported glycosite
- Free / Lactosamine
(avg mass : 674.6106)
Source
Reported glycosite
- Free / Lactosamine
(avg mass : 383.3527)
Source
Reported glycosite
- Free / Lactosamine
(avg mass : 383.3527)