Urine

Taxonomy

• Homo sapiens (Human)
• Felis catus (Cat)
• Mus musculus (House mouse)
• Rattus norvegicus (Norway rat)

Protein

• 3-O-beta-D-glucopyranosyl-alpha-L-fucopyranosyl-L-threonine / Homo sapiens    
• A disintegrin and metalloproteinase with thrombospondin motifs 5 / Homo sapiens    Q9UNA0
• Afamin / Homo sapiens    P43652
• Aggrecan core protein / Homo sapiens    P16112
• Alpha-1-acid glycoprotein 1 / Homo sapiens    P02763
• Alpha-1-acid glycoprotein 2 / Homo sapiens    P19652
• Alpha-1-antichymotrypsin / Homo sapiens    P01011
• Alpha-1-antitrypsin / Homo sapiens    P01009
• Alpha-2-HS-glycoprotein / Homo sapiens    P02765
• Angiopoietin-related protein 3 / Homo sapiens    Q9Y5C1
• Antithrombin-III / Homo sapiens    P01008
• Apolipoprotein C-III / Homo sapiens    P02656
• Apolipoprotein d / Homo sapiens    P05090
• Apolipoprotein f / Homo sapiens    Q13790
• Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens    P98160
• Beta-2-glycoprotein 1 / Homo sapiens    P02749
• Beta-defensin 1 / Homo sapiens    P60022
• C-C motif chemokine 24 / Homo sapiens    O00175
• Carboxypeptidase b2 / Homo sapiens    Q96IY4
• CD27 antigen / Homo sapiens    P26842
• CD44 antigen / Homo sapiens    P16070
• CD59 glycoprotein / Homo sapiens    P13987
• CD99 antigen / Homo sapiens    P14209
• Cell adhesion molecule 1 / Homo sapiens    Q9BY67
• Ceruloplasmin / Homo sapiens    P00450
• Choriogonadotropin - alpha and beta chains / Homo sapiens    P01215    P0DN86
• Choriogonadotropin beta chain / Homo sapiens    P0DN86
• Chromogranin a / Homo sapiens    P10645
• Clusterin / Homo sapiens    P10909
• Collagen alpha-1(xv) chain / Homo sapiens    P39059
• Complement C1r subcomponent-like protein / Homo sapiens    Q9NZP8
• Complement C4-B / Homo sapiens    P0C0L5
• Complement component c7 / Homo sapiens    P10643
• Complement factor i / Homo sapiens    P05156
• Corticosteroid-binding globulin / Homo sapiens    P08185
• Cyclic amp-responsive element-binding protein 3-like protein 3 / Homo sapiens    Q68CJ9
• Deoxyribonuclease-1 / Homo sapiens    P24855
• Disintegrin and metalloproteinase domain-containing protein 8 / Homo sapiens    P78325
• Ecto-ADP-ribosyltransferase 3 / Homo sapiens    Q13508
• Ecto-adp-ribosyltransferase 3 / Homo sapiens    Q13508
• Erythropoietin / Homo sapiens    P01588
• Extracellular matrix protein 1 / Homo sapiens    Q16610
• Extracellular sulfatase Sulf-2 / Homo sapiens    Q8IWU5
• Fibrillin-1 / Homo sapiens    P35555
• Fibrinogen gamma chain / Homo sapiens    P02679
• Fibroblast growth factor receptor 2 / Homo sapiens    P21802
• Fibronectin / Homo sapiens    P02751
• Fibronectin type III domain-containing protein 4 / Homo sapiens    Q9H6D8
• Fractalkine / Homo sapiens    P78423
• Frizzled-4 / Homo sapiens    Q9ULV1
• Glandular kallikrein 1 / Homo sapiens    P06870
• Glycophorin a, b and c / Homo sapiens    P02724    P04921    P06028
• Glycophorin-A / Homo sapiens    P02724
• Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens    P01215
• Haptoglobin / Homo sapiens    P00738
• Hemopexin / Homo sapiens    P02790
• Hepatitis a virus cellular receptor 2 / Homo sapiens    Q8TDQ0
• HLA class II histocompatibility antigen gamma chain / Homo sapiens    P04233
• Icos ligand / Homo sapiens    O75144
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 2 / Homo sapiens    P01877
• Immunoglobulin heavy constant gamma 1 / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 2 / Homo sapiens    P01859
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Immunoglobulin J chain / Homo sapiens    P01591
• Immunoglobulin lambda-1 light chain / Homo sapiens    P0DOX8
• Insulin-like growth factor II / Homo sapiens    P01344
• Insulin-like growth factor-binding protein 6 / Homo sapiens    P24592
• Inter-alpha-trypsin inhibitor heavy chain h2 / Homo sapiens    P19823
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Interleukin-18-binding protein / Homo sapiens    O95998
• Kallistatin / Homo sapiens    P29622
• Kininogen-1 / Homo sapiens    P01042
• Lactotransferrin / Homo sapiens    P02788
• Leucine-rich alpha-2-glycoprotein / Homo sapiens    P02750
• Leukocyte-associated immunoglobulin-like receptor 1 / Homo sapiens    Q6GTX8
• Lymphatic vessel endothelial hyaluronic acid receptor 1 / Homo sapiens    Q9Y5Y7
• Lysosomal acid phosphatase / Homo sapiens    P11117
• Macrophage colony-stimulating factor 1 / Homo sapiens    P09603
• Membrane protein FAM174A / Homo sapiens    Q8TBP5
• Metalloproteinase inhibitor 1 / Homo sapiens    P01033
• Microfibrillar-associated protein 5 / Homo sapiens    Q13361
• Midasin / Homo sapiens    Q9NU22
• Mucin-1 / Homo sapiens    P15941
• Multimerin-1 / Homo sapiens    Q13201
• Myeloperoxidase / Homo sapiens    P05164
• N-acetylmuramoyl-l-alanine amidase / Homo sapiens    Q96PD5
• Neuroblastoma suppressor of tumorigenicity 1 / Homo sapiens    P41271
• Non-secretory ribonuclease / Homo sapiens    P10153
• Olfactomedin-4 / Homo sapiens    Q6UX06
• Osteopontin / Homo sapiens    P10451
• Ovochymase-1 / Homo sapiens    Q7RTY7
• Phosphoinositide-3-kinase-interacting protein 1 / Homo sapiens    Q96FE7
• Plasma protease c1 inhibitor / Homo sapiens    P05155
• Plasma serine protease inhibitor / Homo sapiens    P05154
• Poliovirus receptor / Homo sapiens    P15151
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Progranulin / Homo sapiens    P28799
• Proheparin-binding EGF-like growth factor / Homo sapiens    Q99075
• Prolactin-inducible protein / Homo sapiens    P12273
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens    Q07954
• Prosaas / Homo sapiens    Q9UHG2
• Prosaposin / Homo sapiens    P07602
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Prostatic acid phosphatase / Homo sapiens    P15309
• Protein AMBP / Homo sapiens    P02760
• Protein delta homolog 1 / Homo sapiens    P80370
• Protein heg homolog 1 / Homo sapiens    Q9ULI3
• Protein YIPF3 / Homo sapiens    Q9GZM5
• Protein-lysine 6-oxidase / Homo sapiens    P28300
• Prothrombin / Homo sapiens    P00734
• Receptor tyrosine-protein kinase erbB-2 / Homo sapiens    P04626
• Receptor-type tyrosine-protein phosphatase-like n / Homo sapiens    Q16849
• Roundabout homolog 4 / Homo sapiens    Q8WZ75
• Semenogelin-2 / Homo sapiens    Q02383
• Serotransferrin / Homo sapiens    P02787
• Serum albumin / Homo sapiens    P02768
• Small integral membrane protein 3 / Homo sapiens    Q9BZL3
• Sparc-like protein 1 / Homo sapiens    Q14515
• Syndecan-2 / Homo sapiens    P34741
• Thrombomodulin / Homo sapiens    P07204
• Thyroxine-binding globulin / Homo sapiens    P05543
• Transmembrane protease serine 2 / Homo sapiens    O15393
• Transmembrane protein C16orf54 / Homo sapiens    Q6UWD8
• Tumor necrosis factor receptor superfamily member 6 / Homo sapiens    P25445
• Tyrosine-protein kinase receptor UFO / Homo sapiens    P30530
• Uncharacterized protein from Urine / Homo sapiens    
• Uncharacterized protein from Urine / Homo sapiens    
• Urine glycopeptide / Homo sapiens    
• Urokinase-type plasminogen activator / Homo sapiens    P00749
• Uromodulin / Homo sapiens    P07911
• Vasorin / Homo sapiens    Q6EMK4
• Versican core protein / Homo sapiens    P13611
• Vitamin k-dependent protein c / Homo sapiens    P04070
• WAP four-disulfide core domain protein 2 / Homo sapiens    Q14508
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Major urinary protein / Mus musculus    

Source

• Urine (UBERON_0001088)  

Reported structure

• C-Linked / Undefined core / Man
• Free / Lactosamine / Neu5,9Ac2(a2-6)Gal(b1-4)GlcNAc
• Free / Lactosamine / NeuAc(a2-3)Gal(b1-3)GlcNAc(a1-P)
• Free / Lactosamine / NeuAc(a2-3)Gal(b1-4)GlcNAc(a1-P)
• Free / Lactosamine / NeuAc(a2-6)Gal(b1-4)GlcNAc(a1-P)
• Free / Lactose / Fuc(a1-2)Gal(b1-4)Glc
• Free / Lactose / NeuAc(a2-3)Gal(b1-4)Glc
• Free / Lactose / NeuAc(a2-6)Gal(b1-4)Glc
• Free / Lactose / Neu5,9Ac2(a2-3)Gal(b1-4)Glc
• Free / No-core / NeuAc
• Free / No-core / Man(b1-4)GlcNAc
• Free / No-core / NeuAc(a2-3)Man(b1-4)Glc
• Free / No-core / NeuAc(a2-6)Man(b1-4)GlcNAc
• Free / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-3)Man(b1-4)GlcNAc
• Free / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc
• Free / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-4)Man(a1-3)Man(b1-4)GlcNAc
• Free / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-4)Man(a1-6)Man(b1-4)GlcNAc
• Free / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-3)[Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc
• Free / Truncated / Fuc(a1-6)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc
• N-Linked / Complex / Fuc(a1-3)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Fuc(a1-3)GlcNAc(b1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-3)GlcNAc(b1-2)Man(a1-3)[Gal(b1-3)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-3)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-?)GlcNAc(b1-2)Man(a1-?)[Gal(b1-?)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[HSO3(-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-3)GlcNAc(b1-2)[Gal(b1-3)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-3)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-3)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-3)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-3)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Fuc(a1-3)[GalNAc(b1-4)]GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Fuc(a1-3)[GalNAc(b1-4)]GlcNAc(b1-2)Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc
• N-Linked / Complex / HSO3(-4)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[HSO3(-4)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / HSO3(-4)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-6)[Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-6)[Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-4)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc+"+ NeuAc"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-2)[HSO3(-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / HSO3(-4)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-?)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-6)Gal(b1-?)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[GalNAc(b1-4)GlcNAc(b1-6)]Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)[GalNAc(b1-4)GlcNAc(b1-6)]Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-2)[HSO3(-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Neu?c(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Neu?c(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-3)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc+"+ 2 x NeuAc"
• N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc
• N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-2)[HSO3(-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[HSO3(-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[HSO3(-4)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-2)[HSO3(-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)[NeuAc(a2-3)]GlcNAc(b1-2)Man(a1-?)[NeuAc(a2-6)Gal(b1-?)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-3)GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-4)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-6)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-2)[HSO3(-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[HSO3(-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)[GalNAc(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3) + 2 x NeuAc"
• N-Linked / Complex / GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-4)[HSO3(-3)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[HSO3(-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3)"
• N-Linked / Complex / GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-4)[HSO3(-3)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc+"+ Gal(b1-2)GlcNAc(b1-3) + 3 x NeuAc"
• N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-?)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)]Man(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-?)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc
• N-Linked / Complex / GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-6)[HSO3(-3)Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[HSO3(-3)Gal(b1-4)GlcNAc(b1-2)[HSO3(-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-2)[HSO3(-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc+"+ 2 x Gal(b1-4)GlcNAc(b1-3) + 2 x NeuAc"
• N-Linked / Complex / GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-4)[HSO3(-3)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / GlcNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x Gal(b1-4)GlcNAc(b1-3)"
• N-Linked / Complex / GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-6)[HSO3(-3)Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[HSO3(-3)Gal(b1-4)GlcNAc(b1-2)[HSO3(-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-2)[HSO3(-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ HSO3(-3) + 3 x NeuAc(a2-3)"
• N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)]Man(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)]Man(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc+"+ 2 x Gal(b1-4)GlcNAc(b1-3) + 3 x NeuAc"
• N-Linked / Complex / GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[HSO3(-3)Gal(b1-4)GlcNAc(b1-2)[HSO3(-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-2)[GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[HSO3(-3)Gal(b1-4)GlcNAc(b1-2)[HSO3(-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-2)[GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[HSO3(-3)Gal(b1-4)GlcNAc(b1-2)[HSO3(-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[HSO3(-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-2)[GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-2)[GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-2)[GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Man"
• N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-2)Man(a1-?)[Man(a1-?)]Man(a1-6)[Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / No-core / Fuc(a1-6)[Gal(b1-4)]GlcNAc
• N-Linked / No-core / Man(a1-3)Man(b1-4)GlcNAc
• N-Linked / No-core / Man(a1-6)Man(b1-4)GlcNAc
• N-Linked / No-core / NeuAc(a2-3)Gal(b1-4)GlcNAc
• N-Linked / No-core / NeuAc(a2-6)Gal(b1-4)GlcNAc
• N-Linked / No-core / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc
• N-Linked / No-core / Man(a1-3)Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / No-core / Man(a1-6)Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / No-core / Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / No-core / NeuAc(a2-8)NeuAc(a2-3)Gal(b1-4)GlcNAc
• N-Linked / No-core / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc
• N-Linked / No-core / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc
• N-Linked / No-core / Gal(b1-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc
• N-Linked / No-core / Man(a1-2)Man(a1-6)Man(a1-6)Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / No-core / Man(a1-3)[Man(a1-6)]Man(a1-6)Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / No-core / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)Man(b1-4)GlcNAc
• N-Linked / No-core / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc
• N-Linked / No-core / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)Man(b1-4)GlcNAc
• N-Linked / No-core / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc
• N-Linked / No-core / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)Man(b1-4)GlcNAc
• N-Linked / No-core / Fuc(a1-3)GlcNAc(b1-2)Man(a1-3)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / No-core / Fuc(a1-3)GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / No-core / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / No-core / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / No-core / Gal(b1-4)GlcNAc(b1-4)Man(a1-3)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / No-core / Gal(b1-4)GlcNAc(b1-6)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / No-core / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)Man(b1-4)GlcNAc
• N-Linked / No-core / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / No-core / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / No-core / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-4)Man(a1-3)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / No-core / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-3)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-4)Man(a1-3)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / No-core / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-3)Man(b1-4)GlcNAc
• N-Linked / No-core / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / No-core / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)Man(b1-4)GlcNAc
• N-Linked / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)[Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-6)]Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• O-Linked / Core 0 / GalNAc
• O-Linked / Core 0 / NeuAc(a2-6)GalNAc
• O-Linked / Core 1 / Gal(b1-3)GalNAc
• O-Linked / Core 1 / Gal(b1-3)[NeuAc(a2-6)]GalNAc
• O-Linked / Core 1 / NeuAc(a2-3)Gal(b1-3)GalNAc
• O-Linked / Core 1 / Structure 9458
• O-Linked / Core 1 / Neu5Ac(?2-?)Gal(b1-3)[Neu5Ac(?2-?)]GalNAc(a1-
• O-Linked / Core 1 / NeuAc(?2-6)Gal(b1-3)[NeuAc(a2-6)]GalNAc
• O-Linked / Core 1 / NeuAc(a2-3)Gal(b1-3)[NeuAc(a2-6)]GalNAc
• O-Linked / Core 1 / Structure 9323
• O-Linked / Core 1 / Structure 9311
• O-Linked / Core 1 / Structure 9242
• O-Linked / Core 1 / Structure 9345
• O-Linked / Core 1 / Structure 9295
• O-Linked / Core 1 / Structure 9335
• O-Linked / Core 2 / Gal(b1-3)[GlcNAc(b1-6)]GalNAc
• O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
• O-Linked / Core 2 / NeuAc(a2-6)Gal(b1-3)[GlcNAc(b1-6)]GalNAc
• O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc+"+ NeuAc(a2-3)"
• O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
• O-Linked / Core 2 / NeuAc(?2-?)Gal(?1-?)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
• O-Linked / Core 2 / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
• O-Linked / Core 2 / Structure 9364
• O-Linked / Core 2 / Structure 9504
• O-Linked / Core 2 / Structure 9519
• O-Linked / Core 2 / NeuAc(?2-?)Gal(?1-?)GlcNAc(b1-6)[NeuAc(?2-?)Gal(b1-3)]GalNAc
• O-Linked / Core 2 / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
• O-Linked / Core 2 / Structure 9362
• O-Linked / Core 2 / Structure 9322
• O-Linked / Core 2 / Structure 9351
• O-Linked / Core 2 / Structure 9435
• O-Linked / Core 2 / Structure 9359
• O-Linked / Core 2 / Structure 9432
• O-Linked / Core 2 / Structure 9518
• O-Linked / Core 2 / Structure 9413
• O-Linked / Core 2 / Structure 9253
• O-Linked / Core 2 / Structure 9366
• O-Linked / Core 2 / Structure 9361
• O-Linked / Core 2 / Structure 9365
• O-Linked / Core 2 / Structure 9530
• O-Linked / Core 2 / Structure 9360
• O-Linked / Core 2 / Structure 9383
• O-Linked / Core 2 / Structure 9382
• O-Linked / Core 2 / Structure 9387
• O-Linked / Core 2 / Structure 9391
• O-Linked / Core 2 / Structure 9467
• O-Linked / Core 2 / Structure 9363
• O-Linked / Core 2 / Structure 9436
• O-Linked / Core 2 / Structure 9543
• O-Linked / Core 2 / Structure 9528
• O-Linked / Core 2 / Structure 9369
• O-Linked / Core 2 / Structure 9479
• O-Linked / Core 2 / Structure 9434
• O-Linked / Core 3 / Structure 9358
• O-Linked / No-core / Fuc
• O-Linked / No-core / Glc(b1-3)Fuc
• O-Linked / No-core / HSO3(-3)GlcA(b1-3)Gal(b1-3)Gal(b1-4)Xyl
• O-Linked / No-core / HSO3(-3)GlcA(b1-3)Gal(b1-3)[NeuAc(a2-6)]Gal(b1-4)Xyl
• O-Linked / Undefined core / NeuAc(?2-?)Gal(?1-?)GalNAc(?1-?)GalNAc

Composition

• NeuAc:1 (avg mass : 309.2732 )
• dHex:1 (avg mass : 164.1583 )
• HexNAc:1 (avg mass : 221.2103 )
• HexNAc:1 NeuAc:1 (avg mass : 512.4682 )
• HexNAc:1 dHex:1 (avg mass : 367.3533 )
• HexNAc:2 (avg mass : 424.4053 )
• HexNAc:2 NeuAc:1 (avg mass : 715.6632 )
• HexNAc:2 dHex:1 (avg mass : 570.5483 )
• HexNAc:3 dHex:1 (avg mass : 773.7433 )
• Hex:1 (avg mass : 180.1577 )
• Hex:1 dHex:1 (avg mass : 326.3007 )
• Hex:1 HexNAc:1 (avg mass : 383.3527 )
• Hex:1 HexNAc:1 Su:1 (avg mass : 463.4169 )
• Hex:1 HexNAc:1 NeuAc:1 (avg mass : 674.6106 )
• Hex:1 HexNAc:1 NeuAc:1 Ac:1 (avg mass : 716.6473 )
• Hex:1 HexNAc:1 NeuAc:1 Ph:1 (avg mass : 754.5905 )
• Hex:1 HexNAc:1 NeuAc:1 NeuGc:1 (avg mass : 981.8679 )
• Hex:1 HexNAc:1 NeuAc:2 (avg mass : 965.8685 )
• Hex:1 HexNAc:1 NeuAc:2 Ac:1 (avg mass : 1007.9052 )
• Hex:1 HexNAc:1 NeuAc:2 Ac:2 (avg mass : 1049.9419 )
• Hex:1 HexNAc:1 NeuAc:3 (avg mass : 1257.1264 )
• Hex:1 HexNAc:1 NeuAc:3 Ac:1 (avg mass : 1299.1631 )
• Hex:1 HexNAc:1 NeuAc:3 Ac:2 (avg mass : 1341.1998 )
• Hex:1 HexNAc:1 NeuAc:3 Ac:3 (avg mass : 1383.2365 )
• Hex:1 HexNAc:1 dHex:1 (avg mass : 529.4957 )
• Hex:1 HexNAc:1 dHex:1 NeuAc:1 (avg mass : 820.7536 )
• Hex:1 HexNAc:2 (avg mass : 586.5477 )
• Hex:1 HexNAc:2 NeuAc:1 (avg mass : 877.8056 )
• Hex:1 HexNAc:2 dHex:1 (avg mass : 732.6907 )
• Hex:1 HexNAc:2 dHex:1 NeuAc:1 (avg mass : 1023.9486 )
• Hex:1 HexNAc:2 dHex:2 (avg mass : 878.8337 )
• Hex:1 HexNAc:3 (avg mass : 789.7427 )
• Hex:1 HexNAc:3 NeuAc:1 (avg mass : 1081.0006 )
• Hex:1 HexNAc:3 dHex:1 (avg mass : 935.8857 )
• Hex:1 HexNAc:4 (avg mass : 992.9377 )
• Hex:1 HexNAc:4 dHex:1 (avg mass : 1139.0807 )
• Hex:2 Pent:1 Su:1 HexA:1 (avg mass : 730.6063 )
• Hex:2 NeuAc:1 (avg mass : 633.558 )
• Hex:2 NeuAc:1 Ac:1 (avg mass : 675.5947 )
• Hex:2 NeuAc:1 Pent:1 Su:1 HexA:1 (avg mass : 1021.8642 )
• Hex:2 dHex:1 (avg mass : 488.4431 )
• Hex:2 HexNAc:1 (avg mass : 545.4951 )
• Hex:2 HexNAc:2 (avg mass : 748.6901 )
• Hex:2 HexNAc:2 NeuAc:1 (avg mass : 1039.948 )
• Hex:2 HexNAc:2 NeuAc:2 (avg mass : 1331.2059 )
• Hex:2 HexNAc:2 NeuAc:2 Ac:1 (avg mass : 1373.2426 )
• Hex:2 HexNAc:2 NeuAc:2 Ac:2 (avg mass : 1415.2793 )
• Hex:2 HexNAc:2 NeuAc:3 Ac:1 (avg mass : 1664.5005 )
• Hex:2 HexNAc:2 NeuAc:3 Ac:2 (avg mass : 1706.5372 )
• Hex:2 HexNAc:2 dHex:1 (avg mass : 894.8331 )
• Hex:2 HexNAc:2 dHex:1 NeuAc:1 (avg mass : 1186.091 )
• Hex:2 HexNAc:2 dHex:1 NeuAc:2 (avg mass : 1477.3489 )
• Hex:2 HexNAc:2 dHex:1 NeuAc:2 Ac:1 (avg mass : 1519.3856 )
• Hex:2 HexNAc:2 dHex:1 NeuAc:2 Ac:2 (avg mass : 1561.4223 )
• Hex:2 HexNAc:2 dHex:2 (avg mass : 1040.9761 )
• Hex:2 HexNAc:2 dHex:2 NeuAc:1 (avg mass : 1332.234 )
• Hex:2 HexNAc:2 dHex:3 (avg mass : 1187.1191 )
• Hex:2 HexNAc:3 NeuAc:1 (avg mass : 1243.143 )
• Hex:2 HexNAc:3 NeuAc:2 (avg mass : 1534.4009 )
• Hex:2 HexNAc:3 dHex:1 (avg mass : 1098.0281 )
• Hex:2 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 1389.286 )
• Hex:2 HexNAc:3 dHex:2 (avg mass : 1244.1711 )
• Hex:2 HexNAc:4 (avg mass : 1155.0801 )
• Hex:2 HexNAc:4 dHex:2 (avg mass : 1447.3661 )
• Hex:3 HexNAc:1 (avg mass : 707.6375 )
• Hex:3 HexNAc:2 (avg mass : 910.8325 )
• Hex:3 HexNAc:2 NeuAc:1 (avg mass : 1202.0904 )
• Hex:3 HexNAc:2 dHex:1 (avg mass : 1056.9755 )
• Hex:3 HexNAc:2 dHex:1 NeuAc:1 (avg mass : 1348.2334 )
• Hex:3 HexNAc:3 (avg mass : 1114.0275 )
• Hex:3 HexNAc:3 NeuAc:1 (avg mass : 1405.2854 )
• Hex:3 HexNAc:3 NeuAc:2 (avg mass : 1696.5433 )
• Hex:3 HexNAc:3 dHex:1 (avg mass : 1260.1705 )
• Hex:3 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 1551.4284 )
• Hex:3 HexNAc:3 dHex:1 NeuAc:2 (avg mass : 1842.6863 )
• Hex:3 HexNAc:3 dHex:2 (avg mass : 1406.3135 )
• Hex:3 HexNAc:3 dHex:2 NeuAc:2 (avg mass : 1988.8293 )
• Hex:3 HexNAc:4 (avg mass : 1317.2225 )
• Hex:3 HexNAc:4 NeuGc:1 (avg mass : 1624.4798 )
• Hex:3 HexNAc:4 dHex:1 (avg mass : 1463.3655 )
• Hex:3 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 1754.6234 )
• Hex:3 HexNAc:4 dHex:2 (avg mass : 1609.5085 )
• Hex:3 HexNAc:5 (avg mass : 1520.4175 )
• Hex:3 HexNAc:5 dHex:1 (avg mass : 1666.5605 )
• Hex:3 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 1957.8184 )
• Hex:3 HexNAc:6 (avg mass : 1723.6125 )
• Hex:3 HexNAc:6 dHex:1 (avg mass : 1869.7555 )
• Hex:3 HexNAc:6 dHex:1 Su:2 (avg mass : 2029.8839 )
• Hex:3 HexNAc:6 dHex:1 NeuGc:1 (avg mass : 2177.0128 )
• Hex:3 HexNAc:6 dHex:1 NeuGc:2 (avg mass : 2484.2701 )
• Hex:3 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2161.0134 )
• Hex:3 HexNAc:6 dHex:1 NeuAc:1 NeuGc:1 (avg mass : 2468.2707 )
• Hex:3 HexNAc:6 dHex:1 NeuAc:2 (avg mass : 2452.2713 )
• Hex:3 HexNAc:6 dHex:2 (avg mass : 2015.8985 )
• Hex:3 HexNAc:6 dHex:2 NeuGc:1 (avg mass : 2323.1558 )
• Hex:3 HexNAc:6 dHex:2 NeuAc:1 (avg mass : 2307.1564 )
• Hex:3 HexNAc:6 dHex:3 (avg mass : 2162.0415 )
• Hex:3 HexNAc:7 (avg mass : 1926.8075 )
• Hex:3 HexNAc:7 dHex:1 (avg mass : 2072.9505 )
• Hex:3 HexNAc:8 (avg mass : 2130.0025 )
• Hex:3 HexNAc:8 dHex:1 (avg mass : 2276.1455 )
• Hex:3 HexNAc:9 dHex:1 (avg mass : 2479.3405 )
• Hex:4 HexNAc:1 (avg mass : 869.7799 )
• Hex:4 HexNAc:2 (avg mass : 1072.9749 )
• Hex:4 HexNAc:2 NeuAc:1 (avg mass : 1364.2328 )
• Hex:4 HexNAc:3 (avg mass : 1276.1699 )
• Hex:4 HexNAc:3 NeuGc:1 (avg mass : 1583.4272 )
• Hex:4 HexNAc:3 NeuAc:1 (avg mass : 1567.4278 )
• Hex:4 HexNAc:3 NeuAc:2 (avg mass : 1858.6857 )
• Hex:4 HexNAc:3 dHex:1 (avg mass : 1422.3129 )
• Hex:4 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 1713.5708 )
• Hex:4 HexNAc:3 dHex:2 (avg mass : 1568.4559 )
• Hex:4 HexNAc:4 (avg mass : 1479.3649 )
• Hex:4 HexNAc:4 NeuGc:1 (avg mass : 1786.6222 )
• Hex:4 HexNAc:4 NeuAc:1 (avg mass : 1770.6228 )
• Hex:4 HexNAc:4 NeuAc:2 (avg mass : 2061.8807 )
• Hex:4 HexNAc:4 NeuAc:3 (avg mass : 2353.1386 )
• Hex:4 HexNAc:4 dHex:1 (avg mass : 1625.5079 )
• Hex:4 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 1916.7658 )
• Hex:4 HexNAc:4 dHex:2 (avg mass : 1771.6509 )
• Hex:4 HexNAc:4 dHex:2 NeuAc:1 (avg mass : 2062.9088 )
• Hex:4 HexNAc:4 dHex:3 (avg mass : 1917.7939 )
• Hex:4 HexNAc:4 dHex:3 NeuAc:1 (avg mass : 2209.0518 )
• Hex:4 HexNAc:5 (avg mass : 1682.5599 )
• Hex:4 HexNAc:5 NeuGc:1 (avg mass : 1989.8172 )
• Hex:4 HexNAc:5 NeuGc:2 (avg mass : 2297.0745 )
• Hex:4 HexNAc:5 NeuAc:1 (avg mass : 1973.8178 )
• Hex:4 HexNAc:5 NeuAc:1 Su:1 (avg mass : 2053.882 )
• Hex:4 HexNAc:5 NeuAc:1 NeuGc:1 (avg mass : 2281.0751 )
• Hex:4 HexNAc:5 NeuAc:2 (avg mass : 2265.0757 )
• Hex:4 HexNAc:5 dHex:1 (avg mass : 1828.7029 )
• Hex:4 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2119.9608 )
• Hex:4 HexNAc:5 dHex:1 NeuAc:1 Su:1 (avg mass : 2200.025 )
• Hex:4 HexNAc:5 dHex:1 NeuAc:1 NeuGc:1 (avg mass : 2427.2181 )
• Hex:4 HexNAc:5 dHex:1 NeuAc:2 (avg mass : 2411.2187 )
• Hex:4 HexNAc:5 dHex:2 (avg mass : 1974.8459 )
• Hex:4 HexNAc:5 dHex:2 NeuAc:1 (avg mass : 2266.1038 )
• Hex:4 HexNAc:6 (avg mass : 1885.7549 )
• Hex:4 HexNAc:6 NeuAc:1 (avg mass : 2177.0128 )
• Hex:4 HexNAc:6 dHex:1 (avg mass : 2031.8979 )
• Hex:4 HexNAc:6 dHex:1 NeuAc:1 Su:1 (avg mass : 2403.22 )
• Hex:4 HexNAc:6 dHex:2 (avg mass : 2178.0409 )
• Hex:4 HexNAc:7 (avg mass : 2088.9499 )
• Hex:4 HexNAc:7 dHex:1 (avg mass : 2235.0929 )
• Hex:4 HexNAc:7 dHex:2 (avg mass : 2381.2359 )
• Hex:4 HexNAc:8 (avg mass : 2292.1449 )
• Hex:4 HexNAc:9 dHex:1 (avg mass : 2641.4829 )
• Hex:5 HexNAc:1 (avg mass : 1031.9223 )
• Hex:5 HexNAc:2 (avg mass : 1235.1173 )
• Hex:5 HexNAc:2 dHex:1 (avg mass : 1381.2603 )
• Hex:5 HexNAc:3 (avg mass : 1438.3123 )
• Hex:5 HexNAc:3 NeuGc:1 (avg mass : 1745.5696 )
• Hex:5 HexNAc:3 NeuAc:1 (avg mass : 1729.5702 )
• Hex:5 HexNAc:3 NeuAc:2 (avg mass : 2020.8281 )
• Hex:5 HexNAc:3 dHex:2 (avg mass : 1730.5983 )
• Hex:5 HexNAc:4 (avg mass : 1641.5073 )
• Hex:5 HexNAc:4 NeuGc:1 (avg mass : 1948.7646 )
• Hex:5 HexNAc:4 NeuGc:2 (avg mass : 2256.0219 )
• Hex:5 HexNAc:4 NeuAc:1 (avg mass : 1932.7652 )
• Hex:5 HexNAc:4 NeuAc:1 Su:1 (avg mass : 2012.8294 )
• Hex:5 HexNAc:4 NeuAc:1 NeuGc:1 (avg mass : 2240.0225 )
• Hex:5 HexNAc:4 NeuAc:2 (avg mass : 2224.0231 )
• Hex:5 HexNAc:4 NeuAc:3 (avg mass : 2515.281 )
• Hex:5 HexNAc:4 dHex:1 (avg mass : 1787.6503 )
• Hex:5 HexNAc:4 dHex:1 Su:2 (avg mass : 1947.7787 )
• Hex:5 HexNAc:4 dHex:1 NeuGc:1 (avg mass : 2094.9076 )
• Hex:5 HexNAc:4 dHex:1 NeuGc:2 (avg mass : 2402.1649 )
• Hex:5 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 2078.9082 )
• Hex:5 HexNAc:4 dHex:1 NeuAc:1 Su:1 (avg mass : 2158.9724 )
• Hex:5 HexNAc:4 dHex:1 NeuAc:1 NeuGc:1 (avg mass : 2386.1655 )
• Hex:5 HexNAc:4 dHex:1 NeuAc:2 (avg mass : 2370.1661 )
• Hex:5 HexNAc:4 dHex:2 (avg mass : 1933.7933 )
• Hex:5 HexNAc:4 dHex:2 NeuAc:1 (avg mass : 2225.0512 )
• Hex:5 HexNAc:4 dHex:3 (avg mass : 2079.9363 )
• Hex:5 HexNAc:4 dHex:3 NeuGc:2 (avg mass : 2694.4509 )
• Hex:5 HexNAc:4 dHex:3 NeuAc:1 (avg mass : 2371.1942 )
• Hex:5 HexNAc:4 dHex:3 NeuAc:1 NeuGc:1 (avg mass : 2678.4515 )
• Hex:5 HexNAc:4 dHex:3 NeuAc:2 (avg mass : 2662.4521 )
• Hex:5 HexNAc:5 (avg mass : 1844.7023 )
• Hex:5 HexNAc:5 NeuGc:1 (avg mass : 2151.9596 )
• Hex:5 HexNAc:5 NeuGc:2 (avg mass : 2459.2169 )
• Hex:5 HexNAc:5 NeuAc:1 (avg mass : 2135.9602 )
• Hex:5 HexNAc:5 NeuAc:1 NeuGc:1 (avg mass : 2443.2175 )
• Hex:5 HexNAc:5 NeuAc:2 (avg mass : 2427.2181 )
• Hex:5 HexNAc:5 dHex:1 (avg mass : 1990.8453 )
• Hex:5 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2282.1032 )
• Hex:5 HexNAc:5 dHex:1 NeuAc:1 NeuGc:1 (avg mass : 2589.3605 )
• Hex:5 HexNAc:5 dHex:1 NeuAc:2 (avg mass : 2573.3611 )
• Hex:5 HexNAc:5 dHex:2 (avg mass : 2136.9883 )
• Hex:5 HexNAc:5 dHex:3 (avg mass : 2283.1313 )
• Hex:5 HexNAc:6 (avg mass : 2047.8973 )
• Hex:5 HexNAc:6 dHex:1 (avg mass : 2194.0403 )
• Hex:5 HexNAc:6 dHex:1 NeuGc:3 (avg mass : 3115.8122 )
• Hex:5 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2485.2982 )
• Hex:5 HexNAc:6 dHex:1 NeuAc:1 NeuGc:1 (avg mass : 2792.5555 )
• Hex:5 HexNAc:6 dHex:1 NeuAc:2 (avg mass : 2776.5561 )
• Hex:5 HexNAc:6 dHex:1 NeuAc:2 NeuGc:1 (avg mass : 3083.8134 )
• Hex:5 HexNAc:6 dHex:1 NeuAc:3 (avg mass : 3067.814 )
• Hex:5 HexNAc:6 dHex:2 (avg mass : 2340.1833 )
• Hex:5 HexNAc:6 dHex:3 (avg mass : 2486.3263 )
• Hex:5 HexNAc:8 (avg mass : 2454.2873 )
• Hex:5 HexNAc:8 dHex:1 (avg mass : 2600.4303 )
• Hex:6 HexNAc:2 (avg mass : 1397.2597 )
• Hex:6 HexNAc:3 (avg mass : 1600.4547 )
• Hex:6 HexNAc:3 NeuGc:1 (avg mass : 1907.712 )
• Hex:6 HexNAc:3 NeuAc:1 (avg mass : 1891.7126 )
• Hex:6 HexNAc:3 dHex:1 NeuGc:1 (avg mass : 2053.855 )
• Hex:6 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 2037.8556 )
• Hex:6 HexNAc:4 (avg mass : 1803.6497 )
• Hex:6 HexNAc:4 NeuGc:1 (avg mass : 2110.907 )
• Hex:6 HexNAc:4 NeuAc:1 (avg mass : 2094.9076 )
• Hex:6 HexNAc:4 NeuAc:2 (avg mass : 2386.1655 )
• Hex:6 HexNAc:4 NeuAc:3 (avg mass : 2677.4234 )
• Hex:6 HexNAc:4 dHex:1 (avg mass : 1949.7927 )
• Hex:6 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 2241.0506 )
• Hex:6 HexNAc:4 dHex:2 (avg mass : 2095.9357 )
• Hex:6 HexNAc:4 dHex:3 (avg mass : 2242.0787 )
• Hex:6 HexNAc:5 (avg mass : 2006.8447 )
• Hex:6 HexNAc:5 Su:2 (avg mass : 2166.9731 )
• Hex:6 HexNAc:5 NeuGc:1 (avg mass : 2314.102 )
• Hex:6 HexNAc:5 NeuGc:2 (avg mass : 2621.3593 )
• Hex:6 HexNAc:5 NeuGc:3 (avg mass : 2928.6166 )
• Hex:6 HexNAc:5 NeuAc:1 (avg mass : 2298.1026 )
• Hex:6 HexNAc:5 NeuAc:1 Su:1 (avg mass : 2378.1668 )
• Hex:6 HexNAc:5 NeuAc:1 Su:2 (avg mass : 2458.231 )
• Hex:6 HexNAc:5 NeuAc:1 NeuGc:1 (avg mass : 2605.3599 )
• Hex:6 HexNAc:5 NeuAc:1 NeuGc:2 (avg mass : 2912.6172 )
• Hex:6 HexNAc:5 NeuAc:2 (avg mass : 2589.3605 )
• Hex:6 HexNAc:5 NeuAc:2 Su:1 (avg mass : 2669.4247 )
• Hex:6 HexNAc:5 NeuAc:2 NeuGc:1 (avg mass : 2896.6178 )
• Hex:6 HexNAc:5 NeuAc:3 (avg mass : 2880.6184 )
• Hex:6 HexNAc:5 dHex:1 (avg mass : 2152.9877 )
• Hex:6 HexNAc:5 dHex:1 Su:2 (avg mass : 2313.1161 )
• Hex:6 HexNAc:5 dHex:1 Su:3 (avg mass : 2393.1803 )
• Hex:6 HexNAc:5 dHex:1 NeuGc:1 (avg mass : 2460.245 )
• Hex:6 HexNAc:5 dHex:1 NeuGc:2 (avg mass : 2767.5023 )
• Hex:6 HexNAc:5 dHex:1 NeuGc:3 (avg mass : 3074.7596 )
• Hex:6 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2444.2456 )
• Hex:6 HexNAc:5 dHex:1 NeuAc:1 Su:2 (avg mass : 2604.374 )
• Hex:6 HexNAc:5 dHex:1 NeuAc:1 NeuGc:1 (avg mass : 2751.5029 )
• Hex:6 HexNAc:5 dHex:1 NeuAc:1 NeuGc:2 (avg mass : 3058.7602 )
• Hex:6 HexNAc:5 dHex:1 NeuAc:2 (avg mass : 2735.5035 )
• Hex:6 HexNAc:5 dHex:1 NeuAc:2 Su:1 (avg mass : 2815.5677 )
• Hex:6 HexNAc:5 dHex:1 NeuAc:2 NeuGc:1 (avg mass : 3042.7608 )
• Hex:6 HexNAc:5 dHex:1 NeuAc:3 (avg mass : 3026.7614 )
• Hex:6 HexNAc:5 dHex:2 (avg mass : 2299.1307 )
• Hex:6 HexNAc:5 dHex:2 NeuAc:1 (avg mass : 2590.3886 )
• Hex:6 HexNAc:5 dHex:3 (avg mass : 2445.2737 )
• Hex:6 HexNAc:5 dHex:3 NeuGc:1 (avg mass : 2752.531 )
• Hex:6 HexNAc:5 dHex:3 NeuAc:1 (avg mass : 2736.5316 )
• Hex:6 HexNAc:6 NeuAc:1 (avg mass : 2501.2976 )
• Hex:6 HexNAc:6 NeuAc:1 NeuGc:1 (avg mass : 2808.5549 )
• Hex:6 HexNAc:6 NeuAc:2 (avg mass : 2792.5555 )
• Hex:6 HexNAc:6 dHex:1 (avg mass : 2356.1827 )
• Hex:6 HexNAc:6 dHex:1 NeuGc:3 (avg mass : 3277.9546 )
• Hex:6 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2647.4406 )
• Hex:6 HexNAc:6 dHex:1 NeuAc:1 Su:2 (avg mass : 2807.569 )
• Hex:6 HexNAc:6 dHex:1 NeuAc:1 NeuGc:1 (avg mass : 2954.6979 )
• Hex:6 HexNAc:6 dHex:1 NeuAc:2 (avg mass : 2938.6985 )
• Hex:6 HexNAc:6 dHex:1 NeuAc:2 Su:1 (avg mass : 3018.7627 )
• Hex:6 HexNAc:6 dHex:1 NeuAc:2 NeuGc:1 (avg mass : 3245.9558 )
• Hex:6 HexNAc:6 dHex:1 NeuAc:3 (avg mass : 3229.9564 )
• Hex:6 HexNAc:6 dHex:2 (avg mass : 2502.3257 )
• Hex:6 HexNAc:7 (avg mass : 2413.2347 )
• Hex:6 HexNAc:7 dHex:1 (avg mass : 2559.3777 )
• Hex:6 HexNAc:7 dHex:1 NeuAc:2 Su:1 (avg mass : 3221.9577 )
• Hex:6 HexNAc:8 (avg mass : 2616.4297 )
• Hex:6 HexNAc:9 (avg mass : 2819.6247 )
• Hex:6 HexNAc:9 dHex:1 (avg mass : 2965.7677 )
• Hex:7 HexNAc:2 (avg mass : 1559.4021 )
• Hex:7 HexNAc:4 (avg mass : 1965.7921 )
• Hex:7 HexNAc:4 NeuAc:1 (avg mass : 2257.05 )
• Hex:7 HexNAc:4 dHex:1 (avg mass : 2111.9351 )
• Hex:7 HexNAc:4 dHex:2 (avg mass : 2258.0781 )
• Hex:7 HexNAc:5 (avg mass : 2168.9871 )
• Hex:7 HexNAc:5 NeuAc:2 (avg mass : 2751.5029 )
• Hex:7 HexNAc:5 NeuAc:3 (avg mass : 3042.7608 )
• Hex:7 HexNAc:5 NeuAc:4 (avg mass : 3334.0187 )
• Hex:7 HexNAc:5 dHex:1 (avg mass : 2315.1301 )
• Hex:7 HexNAc:5 dHex:1 NeuGc:2 (avg mass : 2929.6447 )
• Hex:7 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2606.388 )
• Hex:7 HexNAc:5 dHex:1 NeuAc:1 NeuGc:1 (avg mass : 2913.6453 )
• Hex:7 HexNAc:5 dHex:1 NeuAc:2 (avg mass : 2897.6459 )
• Hex:7 HexNAc:6 (avg mass : 2372.1821 )
• Hex:7 HexNAc:6 NeuGc:1 (avg mass : 2679.4394 )
• Hex:7 HexNAc:6 NeuGc:2 (avg mass : 2986.6967 )
• Hex:7 HexNAc:6 NeuAc:1 (avg mass : 2663.44 )
• Hex:7 HexNAc:6 NeuAc:1 NeuGc:1 (avg mass : 2970.6973 )
• Hex:7 HexNAc:6 NeuAc:2 (avg mass : 2954.6979 )
• Hex:7 HexNAc:6 NeuAc:2 Su:2 (avg mass : 3114.8263 )
• Hex:7 HexNAc:6 NeuAc:2 NeuGc:1 (avg mass : 3261.9552 )
• Hex:7 HexNAc:6 NeuAc:2 NeuGc:2 (avg mass : 3569.2125 )
• Hex:7 HexNAc:6 NeuAc:3 (avg mass : 3245.9558 )
• Hex:7 HexNAc:6 NeuAc:3 Su:1 (avg mass : 3326.02 )
• Hex:7 HexNAc:6 NeuAc:3 NeuGc:1 (avg mass : 3553.2131 )
• Hex:7 HexNAc:6 NeuAc:4 (avg mass : 3537.2137 )
• Hex:7 HexNAc:6 dHex:1 (avg mass : 2518.3251 )
• Hex:7 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2809.583 )
• Hex:7 HexNAc:6 dHex:1 NeuAc:2 (avg mass : 3100.8409 )
• Hex:7 HexNAc:6 dHex:1 NeuAc:2 Su:2 (avg mass : 3260.9693 )
• Hex:7 HexNAc:6 dHex:1 NeuAc:3 (avg mass : 3392.0988 )
• Hex:7 HexNAc:6 dHex:1 NeuAc:3 Su:1 (avg mass : 3472.163 )
• Hex:7 HexNAc:6 dHex:1 NeuAc:3 NeuGc:1 (avg mass : 3699.3561 )
• Hex:7 HexNAc:6 dHex:1 NeuAc:4 (avg mass : 3683.3567 )
• Hex:7 HexNAc:6 dHex:4 NeuGc:1 (avg mass : 3264.0114 )
• Hex:7 HexNAc:6 dHex:4 NeuAc:1 (avg mass : 3248.012 )
• Hex:7 HexNAc:7 NeuAc:1 Su:3 (avg mass : 3106.8276 )
• Hex:7 HexNAc:7 dHex:1 (avg mass : 2721.5201 )
• Hex:7 HexNAc:7 dHex:1 NeuAc:1 Su:3 (avg mass : 3252.9706 )
• Hex:7 HexNAc:7 dHex:1 NeuAc:2 Su:2 (avg mass : 3464.1643 )
• Hex:7 HexNAc:7 dHex:1 NeuAc:2 NeuGc:1 (avg mass : 3611.2932 )
• Hex:7 HexNAc:7 dHex:1 NeuAc:3 (avg mass : 3595.2938 )
• Hex:7 HexNAc:7 dHex:1 NeuAc:3 Su:1 (avg mass : 3675.358 )
• Hex:7 HexNAc:7 dHex:1 NeuAc:4 (avg mass : 3886.5517 )
• Hex:7 HexNAc:8 (avg mass : 2778.5721 )
• Hex:7 HexNAc:8 NeuAc:2 Su:2 (avg mass : 3521.2163 )
• Hex:7 HexNAc:8 dHex:1 NeuAc:2 Su:2 (avg mass : 3667.3593 )
• Hex:7 HexNAc:9 dHex:1 NeuAc:4 (avg mass : 4292.9417 )
• Hex:7 HexNAc:10 (avg mass : 3184.9621 )
• Hex:7 HexNAc:10 dHex:1 NeuAc:4 (avg mass : 4496.1367 )
• Hex:8 HexNAc:2 (avg mass : 1721.5445 )
• Hex:8 HexNAc:5 (avg mass : 2331.1295 )
• Hex:8 HexNAc:5 dHex:1 (avg mass : 2477.2725 )
• Hex:8 HexNAc:5 dHex:4 (avg mass : 2915.7015 )
• Hex:8 HexNAc:6 NeuAc:1 (avg mass : 2825.5824 )
• Hex:8 HexNAc:6 NeuAc:2 (avg mass : 3116.8403 )
• Hex:8 HexNAc:6 NeuAc:3 (avg mass : 3408.0982 )
• Hex:8 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2971.7254 )
• Hex:8 HexNAc:7 NeuGc:1 (avg mass : 3044.7768 )
• Hex:8 HexNAc:7 NeuAc:1 (avg mass : 3028.7774 )
• Hex:8 HexNAc:7 dHex:1 (avg mass : 2883.6625 )
• Hex:8 HexNAc:7 dHex:1 NeuGc:2 (avg mass : 3498.1771 )
• Hex:8 HexNAc:7 dHex:1 NeuAc:1 (avg mass : 3174.9204 )
• Hex:8 HexNAc:7 dHex:1 NeuAc:1 NeuGc:1 (avg mass : 3482.1777 )
• Hex:8 HexNAc:7 dHex:1 NeuAc:2 (avg mass : 3466.1783 )
• Hex:8 HexNAc:7 dHex:1 NeuAc:2 NeuGc:1 (avg mass : 3773.4356 )
• Hex:8 HexNAc:7 dHex:1 NeuAc:3 (avg mass : 3757.4362 )
• Hex:8 HexNAc:7 dHex:1 NeuAc:4 (avg mass : 4048.6941 )
• Hex:8 HexNAc:8 (avg mass : 2940.7145 )
• Hex:8 HexNAc:8 dHex:1 (avg mass : 3086.8575 )
• Hex:9 HexNAc:2 (avg mass : 1883.6869 )
• Hex:9 HexNAc:5 dHex:1 (avg mass : 2639.4149 )
• Hex:9 HexNAc:6 (avg mass : 2696.4669 )
• Hex:9 HexNAc:6 dHex:1 NeuAc:1 NeuGc:1 (avg mass : 3441.1251 )
• Hex:9 HexNAc:6 dHex:1 NeuAc:2 (avg mass : 3425.1257 )
• Hex:9 HexNAc:8 dHex:1 (avg mass : 3248.9999 )
• Hex:9 HexNAc:9 dHex:1 (avg mass : 3452.1949 )
• Hex:10 HexNAc:2 (avg mass : 2045.8293 )
• Hex:10 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 3296.0102 )
• Hex:10 HexNAc:9 dHex:1 (avg mass : 3614.3373 )
• Hex:10 HexNAc:9 dHex:1 NeuAc:4 (avg mass : 4779.3689 )
• Hex:10 HexNAc:10 dHex:1 (avg mass : 3817.5323 )
• Hex:11 HexNAc:2 (avg mass : 2207.9717 )
• Hex:11 HexNAc:6 dHex:1 (avg mass : 3166.8947 )
• Hex:11 HexNAc:11 NeuGc:1 (avg mass : 4343.984 )
• Hex:11 HexNAc:11 NeuAc:1 (avg mass : 4327.9846 )

Disease

• Anemia, Aplastic (DOID:12449)
• Aspartylglycosaminuria (DOID:0050461)
• Carcinoid Tumor, with multiple liver metastasis
• Choriocarcinoma (DOID:3594)
• Choriocarcinoma, with Hyperthyroidism
• Diabetes Mellitus (DOID:9351)
• Dyscrasia, Plasma Cell (DOID:6536)
• Fucosidosis (DOID:14500)
• Gangliosidosis GM1 (DOID:3322)
• Heavy Chain Disease (DOID:0060125)
• Hydatidiform Mole (DOID:3590)
• Hydatidiform Mole, Invasive (DOID:3590)
• Infantile Sialidosis, Type II (Dysmorphic) (DOID:3343)
• Lysosomal storage disease (DOID:3211)
• Mannosidosis, alpha (DOID:3413)
• Mannosidosis, beta (DOID:3633)
• Prostate cancer (DOID:10283)
• Sialidosis (Mucolipidosis I) (DOID:3343)
• Sialidosis, severe infantile with abdominal ascites (DOID:3343)
• Sialuria (DOID:3659)

Reference

• Novel O-linked sialoglycan structures in human urinary glycoproteins (2020 - Adam Pap, Ervin Tasnadi, Katalin F. Medzihradszky, Zsuzsanna Darula ) / Status : Reviewed
• Extended Sialylated O-Glycan Repertoire of Human Urinary Glycoproteins Discovered and Characterized Using Electron-Transfer/Higher-Energy Collision Dissociation (2019 - Zsuzsanna Darula, Ádám Pap, Katalin F. Medzihradszky) / Status : Reviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD (2012 - Halim A, Nilsson J, Rüetschi U, Hesse C, Larson G) / Status : Reviewed
• Glycosylated major urinary protein of the house mouse: characterization of its N-linked oligosaccharides. (2000 - Mechref Y, Zidek L, Ma W, Novotny M) / Status : Reviewed
• Structure of the asparagine-linked sugar chains of porcine kidney and human urine cerebroside sulfate activator protein. (2000 - Faull K, Johnson J, Kim M, To T, Whitelegge J, Stevens R, Fluharty C, Fluharty A) / Status : Reviewed
• Novel proteoglycan linkage tetrasaccharides of human urinary soluble thrombomodulin, SO4-3GlcAbeta1-3Galbeta1-3(+/-Siaalpha2-6)Galbeta1-4Xyl. (1999 - Wakabayashi H, Natsuka S, Mega T, Otsuki N, Isaji M, Naotsuka M, Koyama S, Kanamori T, Sakai K, Hase S) / Status : Reviewed
• Glycosylation sites and site-specific glycosylation in human Tamm-Horsfall glycoprotein. (1999 - van Rooijen J, Voskamp A, Kamerling J, Vliegenthart J) / Status : Reviewed
• Purification and characterization of the MUC1 mucin-type glycoprotein, epitectin, from human urine: structures of the major oligosaccharide alditols. (1998 - Bhavanandan V, Zhu Q, Yamakami K, Dilulio N, Nair S, Capon C, Lemoine J, Fournet B) / Status : Reviewed
• Sulfated di-, tri- and tetraantennary N-glycans in human Tamm-Horsfall glycoprotein. (1998 - van Rooijen J, Kamerling J, Vliegenthart J) / Status : Reviewed
• Phosphorylation and O-glycosylation sites of human chromogranin A (CGA79-439) from urine of patients with carcinoid tumors. (1998 - Gadroy P, Stridsberg M, Capon C, Michalski J, Strub J, Van Dorsselaer A, Aunis D, Metz-Boutigue M) / Status : Reviewed
• Carbohydrate and peptide structure of the alpha- and beta-subunits of human chorionic gonadotropin from normal and aberrant pregnancy and choriocarcinoma. (1997 - Elliott M, Kardana A, Lustbader J, Cole L) / Status : Reviewed
• Spectroscopic and protein chemical analyses demonstrate the presence of C-mannosylated tryptophan in intact human RNase 2 and its isoforms. (1996 - Loffler A, Doucey M, Jansson A, Muller D, de Beer T, Hess D, Meldal M, Richter W, Vliegenthart J, Hofsteenge J) / Status : Reviewed
• Characterization of four monosialo and a novel disialo Asn N-glycosides from the urine of a patient with aspartylglycosaminuria. (1995 - Irie F, Murakoshi H, Suzuki T, Suzuki Y, Kon K, Ando S, Yoshida K, Hirabayashi Y) / Status : Reviewed
• Rapid and simple approach for the NMR resonance assignment of the carbohydrate chains of an intact glycoprotein. Application of gradient-enhanced natural abundance 1H-13C HSQC and HSQC-TOCSY to the alpha-subunit of human chorionic gonadotropin. (1994 - de Beer T, van Zuylen C, Hard K, Boelens R, Kaptein R, Kamerling J, Vliegenthart J) / Status : Reviewed
• Structural study on the glycosyl-phosphatidylinositol anchor and the asparagine-linked sugar chain of a soluble form of CD59 in human urine. (1994 - Nakano Y, Noda K, Endo T, Kobata A, Tomita M) / Status : Reviewed
• Structural elucidation of a variety of GalNAc-containing N-linked oligosaccharides from human urinary kallidinogenase. (1993 - Tomiya N, Awaya J, Kurono M, Hanzawa H, Shimada I, Arata Y, Yoshida T, Takahashi N) / Status : Reviewed
• Primary structure of N-linked carbohydrate chains of a human chimeric plasminogen activator K2tu-PA expressed in Chinese hamster ovary cells. (1993 - Bergwerff A, van Oostrum J, Asselbergs F, Brgi R, Hokke C, Kamerling J, Vliegenthart J) / Status : Reviewed
• Structures of mucin-type sugar chains on human erythropoietins purified from urine and the culture medium of recombinant Chinese hamster ovary cells. (1993 - Inoue N, Takeuchi M, Asano K, Shimizu R, Takasaki S, Kobata A) / Status : Reviewed
• Human urokinase contains GalNAc beta (1-4)[Fuc alpha (1-3)]GlcNAc beta (1-2) as a novel terminal element in N-linked carbohydrate chains. (1992 - Bergwerff A, Thomas-Oates J, van Oostrum J, Kamerling J, Vliegenthart J) / Status : Reviewed
• Severe infantile sialidosis--the characteristics of oligosaccharides isolated from the urine and the abdominal ascites. (1992 - Nakamura Y, Takahashi Y, Yamaguchi S, Omiya S, Orii T, Yara A, Gushiken M) / Status : Reviewed
• The Asn-linked carbohydrate chains of human Tamm-Horsfall glycoprotein of one male. Novel sulfated and novel N-acetylgalactosamine-containing N-linked carbohydrate chains. (1992 - Hard K, Van Zadelhoff G, Moonen P, Kamerling J, Vliegenthart F) / Status : Reviewed
• Characterization and 400-MHz 1H-NMR analysis of urinary fucosyl glycoasparagines in fucosidosis. (1991 - Michalski J, Wieruszeski J, Alonso C, Cache P, Montreuil J, Strecker G) / Status : Reviewed
• A comparative study of sialyloligosaccharides isolated from sialidosis and galactosialidosis urine. (1991 - van Pelt J, Kamerling J, Bakker H, Vliegenthart J) / Status : Reviewed
• Characterization of a posttranslational fucosylation in the growth factor domain of urinary plasminogen activator. (1991 - Buko A, Kentzer E, Petros A, Menon G, Zuiderweg E, Sarin V) / Status : Reviewed
• Site-specific N-glycosylation of human chorionic gonadotrophin--structural analysis of glycopeptides by one- and two-dimensional 1H NMR spectroscopy. (1991 - Weisshaar G, Hiyama J, Renwick A) / Status : Reviewed
• Characterization of a novel type of chain-terminator Gal beta 1-6Gal beta 1-4)GlcNAc in an oligosaccharide related to N-glycosylated protein glycans isolated from GM1 the urine of patients with gangliosidosis. (1991 - Michalski J, Lemoine J, Wieruszeski J, Fournet B, Montreuil J, Strecker G) / Status : Reviewed
• Different oligosaccharides accumulate in the brain and urine of a cat with alpha-mannosidosis: structure determination of five brain-derived and seventeen urinary oligosaccharides. (1991 - Hard K, Mekking A, Kamerling J, Dacremont G, Vliegenthart J) / Status : Reviewed
• Pregnancy-associated changes in oligomannose oligosaccharides of human and bovine uromodulin (Tamm-Horsfall glycoprotein). (1990 - Smagula R, Van Halbeek H, Decker J, Muchmore A, Moody C, Sherblom A) / Status : Reviewed
• Altered glycosylation of human chorionic gonadotropin decreases its hormonal activity as determined by cyclic-adenosine 3',5'-monophosphate production in MA-10 cells. (1990 - Amano J, Nishimura R, Sato S, Kobata A) / Status : Reviewed
• Sialyl-alpha 2-6-mannosyl-beta 1-4-N-acetylglucosamine, a novel compound occurring in urine of patients with beta-mannosidosis. (1990 - van Pelt J, Dorland L, Duran M, Hokke C, Kamerling J, Vliegenthart J) / Status : Reviewed
• Location and characterization of the three carbohydrate prosthetic groups of human protein HC. (1990 - Escribano J, Lopex-Otin C, Hjerpe A, Grubb A, Mendez E) / Status : Reviewed
• Isolation and structural characterization of sialic-acid-containing glycopeptides of the O-glycosidic type from the urine of two patients with an hereditary deficiency in alpha-N-acetylgalactosaminidase activity. (1989 - Linden H, Klein R, Egge H, Peter-Katalinic J, Dabrowski J, Schindler D) / Status : Reviewed
• Comparative study of the asparagine-linked sugar chains of human erythropoietins purified from urine and the culture medium of recombinant Chinese hamster ovary cells. (1988 - Takeuchi M, Takasaki S, Miyazaki H, Kato T, Hoshi S, Kochibe N, Kobata A) / Status : Reviewed
• Comparative study of the mucin-type sugar chains of human chorionic gonadotropin present in the urine of patients with trophoblastic diseases and healthy pregnant women. (1988 - Amano J, Nishimura R, Mochizuki M, Kobata A) / Status : Reviewed
• Structural analysis of O-glycosidic type of sialyloligosaccharide-alditols derived from urinary glycopeptides of a sialidosis patient. (1988 - van Pelt J, Van Bilsen D, Kamerling J, Vliegenthart J) / Status : Reviewed
• Comparative structural study of N-linked oligosaccharides of urinary and recombinant erythropoietins. (1988 - Tsuda E, Goto M, Murakami A, Akai K, Ueda M, Kawanishi G, Takahashi N, Sasaki R, Chiba H, Ishihara H) / Status : Reviewed
• Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
• Isolation and characterization of novel phosphate-containing sialyloligosaccharides from normal human urine. (1984 - Parkkinen J, Finne J) / Status : Reviewed
• The structure of sialyl-glycopeptides of the O-glycosidic type, isolated from sialidosis (mucolipidosis I) urine. (1984 - Lecat D, Lemonnier M, Derappe C, Lhermitte M, van Halbeek H, Dorland L, Vliegenthart J) / Status : Reviewed
• Isolation and structural characterization of five major sialyloligosaccharides and a sialylglycopeptide from normal human urine. (1983 - Parkkinen J, Finne J) / Status : Reviewed
• Structures of the asparagine-linked sugar chains of human chorionic gonadotropin produced in choriocarcinoma. Appearance of triantennary sugar chains and unique biantennary sugar chains. (1983 - Mizuochi T, Nishimura R, Derappe C, Taniguchi T, Hamamoto T, Mochizuki M, Kobata A) / Status : Reviewed
• Structures of sialylated O-glycosidically and N-glycosidically linked oligosaccharides in a monoclonal immunoglobulin light chain. (1981 - Chandrasekaran EV, Mendicino A, Garver FA, Mendicino J) / Status : Reviewed
• Localization of the carbohydrate units in a human immunoglobulin light chain, protein Sm lambda. (1981 - Garver F, Chang L, Kiefer C, Mendicino J, Chandrasekaran E, Isobe T, Osserman E) / Status : Reviewed
• Urinary oligosaccharides of fucosidosis. Evidence of the occurrence of X-antigenic determinant in serum-type sugar chains of glycoproteins. (1978 - Nishigaki M, Yamashita K, Matsuda I, Arashima S, Kobata A) / Status : Reviewed
• Isolation and identification of 2-deoxy-2,3-dehydro-N-acetylneuraminic acid from the urine of a patient with sialuria. (1975 - Kamerling JP, Vliegenthart JF) / Status : Reviewed
• A new type of carbohydrate-protein linkage in a glycopeptide from normal human urine. (1975 - Hallgren P, Lundblad A, Svensson S) / Status : Reviewed

Reported glycosite

• 3-O-beta-D-glucopyranosyl-alpha-L-fucopyranosyl-L-threonine / Homo sapiens
  •        Undefined site
• A disintegrin and metalloproteinase with thrombospondin motifs 5 / Homo sapiens
  •        Thr-36
• Afamin / Homo sapiens
  •        Asn-33
• Aggrecan core protein / Homo sapiens
  •        Asn-658
• Alpha-1-acid glycoprotein 1 / Homo sapiens
  •        Asn-33
  •        Asn-56
  •        Asn-72
  •        Asn-93
• Alpha-1-acid glycoprotein 2 / Homo sapiens
  •        Asn-33
• Alpha-1-antichymotrypsin / Homo sapiens
  •        Asn-271
• Alpha-1-antitrypsin / Homo sapiens
  •        Asn-70
  •        Asn-271
  •        Thr-273
• Alpha-2-HS-glycoprotein / Homo sapiens
  •        Asn-156
  •        Asn-176
  •        Ser-346
• Angiopoietin-related protein 3 / Homo sapiens
  •        Asn-23
  •        Asn-296
• Antithrombin-III / Homo sapiens
  •        Asn-128
  •        Asn-187
• Apolipoprotein C-III / Homo sapiens
  •        Thr-94
• Apolipoprotein d / Homo sapiens
  •        Asn-65
  •        Asn-98
• Apolipoprotein f / Homo sapiens
  •        Asn-139
  •        Thr-274
• Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
  •        Thr-40
  •        Thr-42
  •        Thr-49
• Beta-2-glycoprotein 1 / Homo sapiens
  •        Asn-162
• Beta-defensin 1 / Homo sapiens
  •        Thr-26
• C-C motif chemokine 24 / Homo sapiens
  •        Asn-115
• Carboxypeptidase b2 / Homo sapiens
  •        Asn-73
  •        Asn-108
• CD27 antigen / Homo sapiens
  •        Asn-95
  •        Ser-127
• CD44 antigen / Homo sapiens
  •        Asn-57
• CD59 glycoprotein / Homo sapiens
  •        Undefined site
  •        Thr-40
  •        Asn-43
  •        Thr-105
  •        Ser-106
  •        Thr-111
• CD99 antigen / Homo sapiens
  •        Thr-41
• Cell adhesion molecule 1 / Homo sapiens
  •        Asn-101
• Ceruloplasmin / Homo sapiens
  •        Asn-138
  •        Asn-358
  •        Ser-360
  •        Asn-397
• Choriogonadotropin - alpha and beta chains / Homo sapiens
  •        Undefined site
• Choriogonadotropin beta chain / Homo sapiens
  •        Undefined site
  •        Asn-33
  •        Asn-50
• Chromogranin a / Homo sapiens
  •        Thr-181
  •        Thr-183
  •        Thr-251
• Clusterin / Homo sapiens
  •        Asn-86
  •        Asn-374
• Collagen alpha-1(xv) chain / Homo sapiens
  •        Thr-265
• Complement C1r subcomponent-like protein / Homo sapiens
  •        Asn-166
• Complement C4-B / Homo sapiens
  •        Asn-226
• Complement component c7 / Homo sapiens
  •        Thr-696
• Complement factor i / Homo sapiens
  •        Asn-103
• Corticosteroid-binding globulin / Homo sapiens
  •        Asn-96
• Cyclic amp-responsive element-binding protein 3-like protein 3 / Homo sapiens
  •        Ser-379
• Deoxyribonuclease-1 / Homo sapiens
  •        Asn-40
• Disintegrin and metalloproteinase domain-containing protein 8 / Homo sapiens
  •        Asn-91
• Ecto-ADP-ribosyltransferase 3 / Homo sapiens
  •        Thr-320
• Ecto-adp-ribosyltransferase 3 / Homo sapiens
  •        Thr-346
• Erythropoietin / Homo sapiens
  •        Undefined site
• Extracellular matrix protein 1 / Homo sapiens
  •        Thr-534
• Extracellular sulfatase Sulf-2 / Homo sapiens
  •        Asn-149
• Fibrillin-1 / Homo sapiens
  •        Asn-1713
  •        Asn-2767
• Fibrinogen gamma chain / Homo sapiens
  •        Ser-68
  •        Asn-78
• Fibroblast growth factor receptor 2 / Homo sapiens
  •        Asn-83
• Fibronectin / Homo sapiens
  •        Asn-528
  •        Asn-1007
• Fibronectin type III domain-containing protein 4 / Homo sapiens
  •        Asn-147
• Fractalkine / Homo sapiens
  •        Thr-183
  •        Ser-253
  •        Thr-272
• Frizzled-4 / Homo sapiens
  •        Asn-144
• Glandular kallikrein 1 / Homo sapiens
  •        Undefined site
• Glycophorin a, b and c / Homo sapiens
  •        Ser-42
• Glycophorin-A / Homo sapiens
  •        Thr-56
• Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
  •        Undefined site
  •        Asn-76
  •        Asn-102
• Haptoglobin / Homo sapiens
  •        Asn-241
• Hemopexin / Homo sapiens
  •        Asn-64
  •        Asn-187
  •        Asn-453
• Hepatitis a virus cellular receptor 2 / Homo sapiens
  •        Thr-145
• HLA class II histocompatibility antigen gamma chain / Homo sapiens
  •        Thr-203
• Icos ligand / Homo sapiens
  •        Asn-70
  •        Asn-102
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Asn-144
• Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •        Asn-205
• Immunoglobulin heavy constant gamma 1 / Homo sapiens
  •        Asn-180
• Immunoglobulin heavy constant gamma 2 / Homo sapiens
  •        Asn-176
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Asn-46
• Immunoglobulin J chain / Homo sapiens
  •        Asn-71
• Immunoglobulin lambda-1 light chain / Homo sapiens
  •        Ser-21
  •        Asn-25
• Insulin-like growth factor II / Homo sapiens
  •        Ser-95
  •        Thr-96
  •        Thr-99
  •        Thr-163
• Insulin-like growth factor-binding protein 6 / Homo sapiens
  •        Thr-126
• Inter-alpha-trypsin inhibitor heavy chain h2 / Homo sapiens
  •        Thr-675
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-81
  •        Asn-577
  •        Ser-709
  •        Thr-725
  •        Ser-733
• Interleukin-18-binding protein / Homo sapiens
  •        Ser-53
  •        Asn-103
  •        Asn-147
• Kallistatin / Homo sapiens
  •        Asn-157
• Kininogen-1 / Homo sapiens
  •        Asn-205
  •        Asn-294
• Lactotransferrin / Homo sapiens
  •        Ser-436
  •        Asn-497
• Leucine-rich alpha-2-glycoprotein / Homo sapiens
  •        Asn-186
  •        Asn-325
• Leukocyte-associated immunoglobulin-like receptor 1 / Homo sapiens
  •        Asn-69
• Lymphatic vessel endothelial hyaluronic acid receptor 1 / Homo sapiens
  •        Asn-53
• Lysosomal acid phosphatase / Homo sapiens
  •        Ser-179
• Macrophage colony-stimulating factor 1 / Homo sapiens
  •        Thr-376
• Membrane protein FAM174A / Homo sapiens
  •        Thr-52
  •        Thr-61
• Metalloproteinase inhibitor 1 / Homo sapiens
  •        Asn-53
• Microfibrillar-associated protein 5 / Homo sapiens
  •        Thr-54
• Midasin / Homo sapiens
  •        Asn-602
• Mucin-1 / Homo sapiens
  •        Undefined site
• Multimerin-1 / Homo sapiens
  •        Asn-136
• Myeloperoxidase / Homo sapiens
  •        Ser-322
  •        Asn-323
  •        Asn-391
  •        Ser-481
  •        Asn-483
• N-acetylmuramoyl-l-alanine amidase / Homo sapiens
  •        Thr-569
• Neuroblastoma suppressor of tumorigenicity 1 / Homo sapiens
  •        Asn-39
• Non-secretory ribonuclease / Homo sapiens
  •        Undefined site
  •        Trp-34
• Olfactomedin-4 / Homo sapiens
  •        Asn-253
  •        Asn-411
• Osteopontin / Homo sapiens
  •        Thr-185
• Ovochymase-1 / Homo sapiens
  •        Ser-965
• Phosphoinositide-3-kinase-interacting protein 1 / Homo sapiens
  •        Thr-38
  •        Ser-39
  •        Ser-58
  •        Asn-66
• Plasma protease c1 inhibitor / Homo sapiens
  •        Asn-25
  •        Ser-36
  •        Thr-47
  •        Thr-48
  •        Asn-69
  •        Asn-238
  •        Asn-253
• Plasma serine protease inhibitor / Homo sapiens
  •        Thr-39
  •        Asn-262
• Poliovirus receptor / Homo sapiens
  •        Asn-120
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-421
  •        Asn-469
  •        Asn-499
  •        Thr-614
  •        Ser-621
  •        Ser-624
  •        Ser-627
  •        Ser-630
• Progranulin / Homo sapiens
  •        Asn-530
  •        Thr-532
• Proheparin-binding EGF-like growth factor / Homo sapiens
  •        Thr-37
  •        Thr-44
  •        Ser-46
  •        Thr-47
• Prolactin-inducible protein / Homo sapiens
  •        Asn-105
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
  •        Thr-4362
  •        Asn-4364
• Prosaas / Homo sapiens
  •        Thr-53
  •        Ser-228
  •        Thr-247
• Prosaposin / Homo sapiens
  •        Thr-214
  •        Asn-215
  •        Ser-216
  •        Thr-217
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-51
  •        Ser-67
  •        Thr-73
  •        Asn-78
  •        Thr-80
  •        Ser-81
• Prostatic acid phosphatase / Homo sapiens
  •        Asn-94
  •        Asn-333
• Protein AMBP / Homo sapiens
  •        Thr-24
  •        Asn-115
  •        Asn-250
  •        Thr-252
  •        Thr-258
• Protein delta homolog 1 / Homo sapiens
  •        Thr-256
• Protein heg homolog 1 / Homo sapiens
  •        Thr-67
  •        Thr-91
  •        Ser-349
  •        Thr-356
• Protein YIPF3 / Homo sapiens
  •        Asn-337
  •        Thr-346
  •        Ser-349
• Protein-lysine 6-oxidase / Homo sapiens
  •        Asn-81
  •        Asn-144
• Prothrombin / Homo sapiens
  •        Asn-121
  •        Asn-143
• Receptor tyrosine-protein kinase erbB-2 / Homo sapiens
  •        Ser-998
• Receptor-type tyrosine-protein phosphatase-like n / Homo sapiens
  •        Thr-441
• Roundabout homolog 4 / Homo sapiens
  •        Asn-246
• Semenogelin-2 / Homo sapiens
  •        Ser-519
• Serotransferrin / Homo sapiens
  •        Asn-432
  •        Asn-630
• Serum albumin / Homo sapiens
  •        Thr-267
  •        Ser-328
• Small integral membrane protein 3 / Homo sapiens
  •        Ser-5
• Sparc-like protein 1 / Homo sapiens
  •        Thr-350
• Syndecan-2 / Homo sapiens
  •        Thr-101
• Thrombomodulin / Homo sapiens
  •        Undefined site
• Thyroxine-binding globulin / Homo sapiens
  •        Asn-36
• Transmembrane protease serine 2 / Homo sapiens
  •        Asn-213
• Transmembrane protein C16orf54 / Homo sapiens
  •        Thr-4
• Tumor necrosis factor receptor superfamily member 6 / Homo sapiens
  •        Thr-28
• Tyrosine-protein kinase receptor UFO / Homo sapiens
  •        Asn-198
• Uncharacterized protein from Urine / Homo sapiens
  •        Undefined site
• Uncharacterized protein from Urine / Homo sapiens
  •        Undefined site
• Urine glycopeptide / Homo sapiens
  •        Undefined site
• Urokinase-type plasminogen activator / Homo sapiens
  •        Thr-38
  •        Asn-322
• Uromodulin / Homo sapiens
  •        Undefined site
  •        Ser-154
  •        Thr-225
  •        Asn-232
  •        Thr-234
  •        Ser-252
  •        Asn-275
  •        Thr-277
  •        Thr-288
  •        Ser-292
  •        Thr-296
  •        Ser-301
  •        Ser-308
  •        Asn-322
  •        Asn-396
  •        Thr-504
  •        Ser-511
  •        Ser-512
  •        Asn-513
• Vasorin / Homo sapiens
  •        Asn-117
• Versican core protein / Homo sapiens
  •        Ser-3024
• Vitamin k-dependent protein c / Homo sapiens
  •        Thr-19
• WAP four-disulfide core domain protein 2 / Homo sapiens
  •        Thr-33
  •        Asn-44
  •        Thr-46
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-109
  •        Asn-128
• Major urinary protein / Mus musculus
  •        Undefined site

Mass spectrometry observed peptide

• PLTPEPPSGR (10aa)
  •    Q6UWD8    Thr-4     Transmembrane protein C16orf54 / Homo sapiens
• MDAVSQVPMEVVLPK (15aa)
  •    Q9BZL3    Ser-5     Small integral membrane protein 3 / Homo sapiens
• EEFDEIPTVVGIF (13aa)
• IDQDNSSFDSLSPEPK (16aa)
  •    Q9Y5C1    Asn-23     Angiopoietin-related protein 3 / Homo sapiens
• ASSNPNATSSSSQDPESLQDRGEGK (25aa)
  •    P05155    Asn-25     Plasma protease c1 inhibitor / Homo sapiens
  •    P05155    Ser-36     Plasma protease c1 inhibitor / Homo sapiens
• GNFLTGLGHR (10aa)
  •    P60022    Thr-26     Beta-defensin 1 / Homo sapiens
• DIENFNSTQK (10aa)
  •    P43652    Asn-33     Afamin / Homo sapiens
• MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGK (42aa)
  •    P02763    Asn-33     Alpha-1-acid glycoprotein 1 / Homo sapiens
• VTACHSSQPNATLYK (15aa)
  •    P05543    Asn-36     Thyroxine-binding globulin / Homo sapiens
• AGQPPTAAAAAQPR (14aa)
  •    Q9UNA0    Thr-36     A disintegrin and metalloproteinase with thrombospondin motifs 5 / Homo sapiens
• ASSNPNATSSSSQDPESLQDR (21aa)
  •    P05155    Asn-25     Plasma protease c1 inhibitor / Homo sapiens
  •    P05155    Ser-36     Plasma protease c1 inhibitor / Homo sapiens
• GLAAGTSNPDPPTVSTDQLLPLGGGR (26aa)
  •    Q99075    Thr-44     Proheparin-binding EGF-like growth factor / Homo sapiens
  •    Q99075    Ser-46     Proheparin-binding EGF-like growth factor / Homo sapiens
  •    Q99075    Thr-37     Proheparin-binding EGF-like growth factor / Homo sapiens
  •    Q99075    Thr-47     Proheparin-binding EGF-like growth factor / Homo sapiens
• GLAAGTSNPDPPTVSTDQLLPLGGGRDR (28aa)
  •    Q99075    Thr-37     Proheparin-binding EGF-like growth factor / Homo sapiens
• GLAAGTSNPDPPTVSTDQLLPLGGGRDRK (29aa)
  •    Q99075    Thr-37     Proheparin-binding EGF-like growth factor / Homo sapiens
• EDQTSPAPGLR (11aa)
  •    Q96FE7    Ser-39     Phosphoinositide-3-kinase-interacting protein 1 / Homo sapiens
  •    Q96FE7    Thr-38     Phosphoinositide-3-kinase-interacting protein 1 / Homo sapiens
• NITQIVGHSGCEAK (14aa)
  •    P41271    Asn-39     Neuroblastoma suppressor of tumorigenicity 1 / Homo sapiens
• MSNATLVSYIVQILSR (16aa)
  •    P24855    Asn-40     Deoxyribonuclease-1 / Homo sapiens
• TAVNCSSDFDACLITKAGLQVYNK (24aa)
  •    P13987    Thr-40     CD59 glycoprotein / Homo sapiens
• TAVNCSSDFDACLITKAGLQVYNKCWK (27aa)
  •    P13987    Thr-40     CD59 glycoprotein / Homo sapiens
• AYDGLSLPEDIETVTASQMR (20aa)
  •    P98160    Thr-40     Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
• SDALPDNENKKPTAIPK (17aa)
  •    P14209    Thr-41     CD99 antigen / Homo sapiens
• SLPEDIETVTASQMR (15aa)
  •    P98160    Thr-42     Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
• TAVNCSSDFDACLITK (16aa)
  •    P13987    Thr-40     CD59 glycoprotein / Homo sapiens
  •    P13987    Asn-43     CD59 glycoprotein / Homo sapiens
• RGLAAGTSNPDPPTVSTDQLLPLGGGR (27aa)
  •    Q99075    Thr-44     Proheparin-binding EGF-like growth factor / Homo sapiens
  •    Q99075    Thr-47     Proheparin-binding EGF-like growth factor / Homo sapiens
• TGVCPELQADQNCTQECVSDSECADNLK (28aa)
  •    Q14508    Thr-33     WAP four-disulfide core domain protein 2 / Homo sapiens
  •    Q14508    Asn-44     WAP four-disulfide core domain protein 2 / Homo sapiens
  •    Q14508    Thr-46     WAP four-disulfide core domain protein 2 / Homo sapiens
• YKNNSDISSTR (11aa)
  •    P01871    Asn-46     Immunoglobulin heavy constant mu / Homo sapiens
• VATTVISK (8aa)
  •    P05155    Thr-47     Plasma protease c1 inhibitor / Homo sapiens
  •    P05155    Thr-48     Plasma protease c1 inhibitor / Homo sapiens
• WTHSYL (6aa)
  •    P98160    Thr-49     Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
• WFSAGLASNSSWLREK (16aa)
  •    P41222    Asn-51     Prostaglandin-h2 d-isomerase / Homo sapiens
• WFSAGLASNSSWLR (14aa)
  •    P41222    Asn-51     Prostaglandin-h2 d-isomerase / Homo sapiens
• TLPPLPPGPTPAQQPGR (17aa)
  •    Q8TBP5    Thr-52     Membrane protein FAM174A / Homo sapiens
  •    Q8TBP5    Thr-61     Membrane protein FAM174A / Homo sapiens
• PRTLPPLPPGPTPAQQPGR (19aa)
  •    Q8TBP5    Thr-52     Membrane protein FAM174A / Homo sapiens
  •    Q8TBP5    Thr-61     Membrane protein FAM174A / Homo sapiens
• FVGTPEVNQTTLYQR (15aa)
  •    P01033    Asn-53     Metalloproteinase inhibitor 1 / Homo sapiens
• ANQQLNFTEAK (11aa)
  •    Q9Y5Y7    Asn-53     Lymphatic vessel endothelial hyaluronic acid receptor 1 / Homo sapiens
• NEEYNK (6aa)
  •    P02763    Asn-56     Alpha-1-acid glycoprotein 1 / Homo sapiens
• DTYAATPR (8aa)
  •    P02724    Thr-56     Glycophorin-A / Homo sapiens
• WFYIASAFRNEEYNK (15aa)
  •    P02763    Asn-56     Alpha-1-acid glycoprotein 1 / Homo sapiens
• AFNSTLPTMAQMEK (14aa)
  •    P16070    Asn-57     CD44 antigen / Homo sapiens
• CLNWLDAQSGLASAPVSGAGNHSYCRNPDEDPR (33aa)
  •    Q96FE7    Ser-58     Phosphoinositide-3-kinase-interacting protein 1 / Homo sapiens
• CSDGWSFDATTLDDNGTMLFFK (22aa)
  •    P02790    Asn-64     Hemopexin / Homo sapiens
• CIQANYSLMENGK (13aa)
  •    P05090    Asn-65     Apolipoprotein d / Homo sapiens
• CLNWLDAQSGLASAPVSGAGNHSYCR (26aa)
  •    Q96FE7    Asn-66     Phosphoinositide-3-kinase-interacting protein 1 / Homo sapiens
• SVVAPATDGGLNLTSTFLRKNQCETR (26aa)
  •    P41222    Ser-81     Prostaglandin-h2 d-isomerase / Homo sapiens
  •    P41222    Asn-78     Prostaglandin-h2 d-isomerase / Homo sapiens
  •    P41222    Thr-80     Prostaglandin-h2 d-isomerase / Homo sapiens
  •    P41222    Ser-67     Prostaglandin-h2 d-isomerase / Homo sapiens
• DLQSLEDILHQVENKTSEVK (20aa)
  •    P02679    Ser-68     Fibrinogen gamma chain / Homo sapiens
• STYNDTEDVSQASPSESEAR (20aa)
  •    Q6GTX8    Asn-69     Leukocyte-associated immunoglobulin-like receptor 1 / Homo sapiens
• MLFVEPILEVSSLPTTNSTTNSATK (25aa)
  •    P05155    Asn-69     Plasma protease c1 inhibitor / Homo sapiens
• TVVTYHIPQNSSLENVDSR (19aa)
  •    O75144    Asn-70     Icos ligand / Homo sapiens
• IIVPLNNRENISDPTSPLR (19aa)
  •    P01591    Asn-71     Immunoglobulin J chain / Homo sapiens
• ENISDPTSPLR (11aa)
  •    P01591    Asn-71     Immunoglobulin J chain / Homo sapiens
• SVQEIQATFFYFTPNK (16aa)
  •    P02763    Asn-72     Alpha-1-acid glycoprotein 1 / Homo sapiens
• KQVHFFVNASDVDNVK (16aa)
  •    Q96IY4    Asn-73     Carboxypeptidase b2 / Homo sapiens
• QVHFFVNASDVDNVK (15aa)
  •    Q96IY4    Asn-73     Carboxypeptidase b2 / Homo sapiens
• SVVAPATDGGLNLTSTFLRK (20aa)
  •    P41222    Asn-78     Prostaglandin-h2 d-isomerase / Homo sapiens
  •    P41222    Thr-73     Prostaglandin-h2 d-isomerase / Homo sapiens
  •    P41222    Ser-67     Prostaglandin-h2 d-isomerase / Homo sapiens
• SVVAPATDGGLNLTSTFLR (19aa)
  •    P41222    Asn-78     Prostaglandin-h2 d-isomerase / Homo sapiens
  •    P41222    Thr-73     Prostaglandin-h2 d-isomerase / Homo sapiens
  •    P41222    Thr-80     Prostaglandin-h2 d-isomerase / Homo sapiens
  •    P41222    Ser-67     Prostaglandin-h2 d-isomerase / Homo sapiens
• DLQSLEDILHQVENK (15aa)
  •    P02679    Asn-78     Fibrinogen gamma chain / Homo sapiens
• RDPGAAVPGAANASAQQPR (19aa)
  •    P28300    Asn-81     Protein-lysine 6-oxidase / Homo sapiens
• DPGAAVPGAANASAQQPR (18aa)
  •    P28300    Asn-81     Protein-lysine 6-oxidase / Homo sapiens
• AFITNFSMIIDGMTYPGIIK (20aa)
  •    Q14624    Asn-81     Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
• DGVHLGPNNR (10aa)
  •    P21802    Asn-83     Fibroblast growth factor receptor 2 / Homo sapiens
• KEDALNETR (9aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• EDALNETR (8aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• DLLGSGYTETYTAANGSEVTEQPR (24aa)
  •    P78325    Asn-91     Disintegrin and metalloproteinase domain-containing protein 8 / Homo sapiens
• APEPGAATQR (10aa)
  •    Q9ULI3    Thr-91     Protein heg homolog 1 / Homo sapiens
• QDQCIYNTTYLNVQR (15aa)
  •    P02763    Asn-93     Alpha-1-acid glycoprotein 1 / Homo sapiens
• FLNESYK (7aa)
  •    P15309    Asn-94     Prostatic acid phosphatase / Homo sapiens
• NCTITANAECACR (13aa)
  •    P26842    Asn-95     CD27 antigen / Homo sapiens
• AQLLQGLGFNLTER (14aa)
  •    P08185    Asn-96     Corticosteroid-binding globulin / Homo sapiens
• ADGTVNQIEGEATPVNLTEPAKLEVK (26aa)
  •    P05090    Asn-98     Apolipoprotein d / Homo sapiens
• ADGTVNQIEGEATPVNLTEPAK (22aa)
  •    P05090    Asn-98     Apolipoprotein d / Homo sapiens
• DVSTPPTVLPDNFPR (15aa)
  •    P01344    Thr-99     Insulin-like growth factor II / Homo sapiens
  •    P01344    Ser-95     Insulin-like growth factor II / Homo sapiens
  •    P01344    Thr-96     Insulin-like growth factor II / Homo sapiens
• SERDVSTPPTVLPDNFPR (18aa)
  •    P01344    Thr-99     Insulin-like growth factor II / Homo sapiens
• FQLLNFSSSELK (12aa)
  •    Q9BY67    Asn-101     Cell adhesion molecule 1 / Homo sapiens
• LFNVTPQDEQK (11aa)
  •    O75144    Asn-102     Icos ligand / Homo sapiens
• FLNNGTCTAEGK (12aa)
  •    P05156    Asn-103     Complement factor i / Homo sapiens
• DLCNFNEQLENGGTSLSEK (19aa)
  •    P13987    Ser-106     CD59 glycoprotein / Homo sapiens
  •    P13987    Thr-105     CD59 glycoprotein / Homo sapiens
• KDLCNFNEQLENGGTSLSEK (20aa)
  •    P13987    Thr-105     CD59 glycoprotein / Homo sapiens
• TFYWDFYTNR (10aa)
  •    P12273    Asn-105     Prolactin-inducible protein / Homo sapiens
• DIVEYYNDSNGSHVLQGR (18aa)
  •    P25311    Asn-109     Zinc-alpha-2-glycoprotein / Homo sapiens
• DLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP (37aa)
  •    P13987    Thr-111     CD59 glycoprotein / Homo sapiens
  •    P13987    Ser-106     CD59 glycoprotein / Homo sapiens
• YPGNQTTC (8aa)
  •    O00175    Asn-115     C-C motif chemokine 24 / Homo sapiens
• WNITMESYVVHTNYDEYAIFLTK (23aa)
  •    P02760    Asn-115     Protein AMBP / Homo sapiens
• LHEITNETFR (10aa)
  •    Q6EMK4    Asn-117     Vasorin / Homo sapiens
• DKLAACLEGNCAEGLGTNYRGHVNITR (27aa)
  •    P00734    Asn-121     Prothrombin / Homo sapiens
• GHVNITR (7aa)
  •    P00734    Asn-121     Prothrombin / Homo sapiens
• GHVNITRSGIECQLWR (16aa)
  •    P00734    Asn-121     Prothrombin / Homo sapiens
• ESKPQAGTARPQDVNR (16aa)
  •    P24592    Thr-126     Insulin-like growth factor-binding protein 6 / Homo sapiens
• FGCEIENNR (9aa)
  •    P25311    Asn-128     Zinc-alpha-2-glycoprotein / Homo sapiens
• LGACNDTLQQLMEVFK (16aa)
  •    P01008    Asn-128     Antithrombin-III / Homo sapiens
• FNPGAESVVLSNSTLK (16aa)
  •    Q13201    Asn-136     Multimerin-1 / Homo sapiens
• EHEGAIYPDNTTDFQR (16aa)
  •    P00450    Asn-138     Ceruloplasmin / Homo sapiens
• NVSVEALASALQLLAR (16aa)
  •    Q13790    Asn-139     Apolipoprotein f / Homo sapiens
• YPHKPEINSTTHPGADLQENFCR (23aa)
  •    P00734    Asn-143     Prothrombin / Homo sapiens
• SRYPHKPEINSTTHPGADLQENFCR (25aa)
  •    P00734    Asn-143     Prothrombin / Homo sapiens
• EFGFAWPESLNCSK (14aa)
  •    Q9ULV1    Asn-144     Frizzled-4 / Homo sapiens
• AENQTAPGEVPALSNLRPPSR (21aa)
  •    P28300    Asn-144     Protein-lysine 6-oxidase / Homo sapiens
• DFTAAFPR (8aa)
  •    Q8TDQ0    Thr-145     Hepatitis a virus cellular receptor 2 / Homo sapiens
• ALVLEQLTPALHSTNFSCVLVDPEQVVQR (29aa)
  •    O95998    Asn-147     Interleukin-18-binding protein / Homo sapiens
• LPSNSSSPGDITVEGLDGER (20aa)
  •    Q9H6D8    Asn-147     Fibronectin type III domain-containing protein 4 / Homo sapiens
• YLNEYNGSYVPPGWKEWVGLLK (22aa)
  •    Q8IWU5    Asn-149     Extracellular sulfatase Sulf-2 / Homo sapiens
• GDGWHCECSPGSCGPGLDCVPEGDALVCADPCQAHR (36aa)
  •    P07911    Ser-154     Uromodulin / Homo sapiens
• KVCQDCPLLAPLNDTR (16aa)
  •    P02765    Asn-156     Alpha-2-HS-glycoprotein / Homo sapiens
• VCQDCPLLAPLNDTR (15aa)
  •    P02765    Asn-156     Alpha-2-HS-glycoprotein / Homo sapiens
• FLNDTMAVYEAK (12aa)
  •    P29622    Asn-157     Kallistatin / Homo sapiens
• VYKPSAGNNSLYR (13aa)
  •    P02749    Asn-162     Beta-2-glycoprotein 1 / Homo sapiens
• GFLALYQTVAVNYSQPISEASR (22aa)
  •    Q9NZP8    Asn-166     Complement C1r subcomponent-like protein / Homo sapiens
• TKPREEQFNSTFR (13aa)
  •    P01859    Asn-176     Immunoglobulin heavy constant gamma 2 / Homo sapiens
• AALAAFNAQNNGSNFQLEEISR (22aa)
  •    P02765    Asn-176     Alpha-2-HS-glycoprotein / Homo sapiens
• EEQFNSTFR (9aa)
  •    P01859    Asn-176     Immunoglobulin heavy constant gamma 2 / Homo sapiens
• QTPEYQNESSR (11aa)
  •    P11117    Ser-179     Lysosomal acid phosphatase / Homo sapiens
• EEQYNSTYR (9aa)
  •    P01857    Asn-180     Immunoglobulin heavy constant gamma 1 / Homo sapiens
• TKPREEQYNSTYR (13aa)
  •    P01857    Asn-180     Immunoglobulin heavy constant gamma 1 / Homo sapiens
• AQDGGPVGTELFR (13aa)
  •    P78423    Thr-183     Fractalkine / Homo sapiens
• RPDIQYPDATDEDITSHMESEELNGAYK (28aa)
  •    P10451    Thr-185     Osteopontin / Homo sapiens
• KLPPGLLANFTLLR (14aa)
  •    P02750    Asn-186     Leucine-rich alpha-2-glycoprotein / Homo sapiens
• LPPGLLANFTLLR (13aa)
  •    P02750    Asn-186     Leucine-rich alpha-2-glycoprotein / Homo sapiens
• SWPAVGNCSSALR (13aa)
  •    P02790    Asn-187     Hemopexin / Homo sapiens
• SLTFNETYQDISELVYGAK (19aa)
  •    P01008    Asn-187     Antithrombin-III / Homo sapiens
• SLHVPGLNK (9aa)
  •    P30530    Asn-198     Tyrosine-protein kinase receptor UFO / Homo sapiens
• ITYSIVQTNCSK (12aa)
  •    P01042    Asn-205     Kininogen-1 / Homo sapiens
• TPLTANITK (9aa)
  •    P01877    Asn-205     Immunoglobulin heavy constant alpha 2 / Homo sapiens
• LNTSAGNVDIYK (12aa)
  •    O15393    Asn-213     Transmembrane protease serine 2 / Homo sapiens
• TNSTFVQALVEHVKEECDR (19aa)
  •    P07602    Ser-216     Prosaposin / Homo sapiens
  •    P07602    Thr-217     Prosaposin / Homo sapiens
  •    P07602    Asn-215     Prosaposin / Homo sapiens
  •    P07602    Thr-214     Prosaposin / Homo sapiens
• MAETCVPVLRCNTAAPMWLNGTHPSSDEGIVSR (33aa)
  •    P07911    Thr-225     Uromodulin / Homo sapiens
• FSDGLESNSSTQFEVK (16aa)
  •    P0C0L5    Asn-226     Complement C4-B / Homo sapiens
• CNTAAPMWLNGTHPSSDEGIVSR (23aa)
  •    P07911    Asn-232     Uromodulin / Homo sapiens
  •    P07911    Thr-225     Uromodulin / Homo sapiens
  •    P07911    Thr-234     Uromodulin / Homo sapiens
• DTFVNASR (8aa)
  •    P05155    Asn-238     Plasma protease c1 inhibitor / Homo sapiens
• VVLHPNYSQVDIGLIK (16aa)
  •    P00738    Asn-241     Haptoglobin / Homo sapiens
• IQLENVTLLNPDPAEGPKPR (20aa)
  •    Q8WZ75    Asn-246     Roundabout homolog 4 / Homo sapiens
• YFYNGTSMACETFQYGGCMGNGNNFVTEK (29aa)
  •    P02760    Thr-252     Protein AMBP / Homo sapiens
  •    P02760    Thr-258     Protein AMBP / Homo sapiens
  •    P02760    Asn-250     Protein AMBP / Homo sapiens
• YFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCR (36aa)
  •    P02760    Thr-252     Protein AMBP / Homo sapiens
• ACAHWSGHCCLWDASVQVKACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGR (66aa)
  •    P07911    Ser-252     Uromodulin / Homo sapiens
  •    P07911    Asn-275     Uromodulin / Homo sapiens
• DQNTPVVHPPPTPGSCGHGGVVNISK (26aa)
  •    Q6UX06    Asn-253     Olfactomedin-4 / Homo sapiens
• VWGQGQSPRPENSLER (16aa)
  •    P78423    Ser-253     Fractalkine / Homo sapiens
• VWGQGQSPRPE (11aa)
  •    P78423    Ser-253     Fractalkine / Homo sapiens
• VLSNNSDANLELINTWVAK (19aa)
  •    P05155    Asn-253     Plasma protease c1 inhibitor / Homo sapiens
• VVGVPYQGNATALFILPSEGK (21aa)
  •    P05154    Asn-262     Plasma serine protease inhibitor / Homo sapiens
• VHTECCHGDLLECADDR (17aa)
  •    P02768    Thr-267     Serum albumin / Homo sapiens
• YTGNASALFILPDQDK (16aa)
  •    P01011    Asn-271     Alpha-1-antichymotrypsin / Homo sapiens
• YLGNATAIFFLPDEGK (16aa)
  •    P01009    Thr-273     Alpha-1-antitrypsin / Homo sapiens
  •    P01009    Asn-271     Alpha-1-antitrypsin / Homo sapiens
• EEMGPVPAHTDAF (13aa)
  •    P78423    Thr-272     Fractalkine / Homo sapiens
• ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCK (42aa)
  •    P07911    Thr-296     Uromodulin / Homo sapiens
  •    P07911    Ser-292     Uromodulin / Homo sapiens
  •    P07911    Thr-288     Uromodulin / Homo sapiens
  •    P07911    Thr-277     Uromodulin / Homo sapiens
  •    P07911    Asn-275     Uromodulin / Homo sapiens
• ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGR (47aa)
  •    P07911    Thr-296     Uromodulin / Homo sapiens
  •    P07911    Ser-301     Uromodulin / Homo sapiens
  •    P07911    Thr-277     Uromodulin / Homo sapiens
  •    P07911    Asn-275     Uromodulin / Homo sapiens
• LNAENNATFYFK (12aa)
  •    P01042    Asn-294     Kininogen-1 / Homo sapiens
• ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGRWHCQCK (53aa)
  •    P07911    Thr-296     Uromodulin / Homo sapiens
  •    P07911    Ser-308     Uromodulin / Homo sapiens
  •    P07911    Thr-277     Uromodulin / Homo sapiens
• IDGSQNFNETWENYK (15aa)
  •    Q9Y5C1    Asn-296     Angiopoietin-related protein 3 / Homo sapiens
• ILEPTQIPGMK (11aa)
  •    Q13508    Thr-320     Ecto-ADP-ribosyltransferase 3 / Homo sapiens
• WHCQCKQDFNITDISLLEHR (20aa)
  •    P07911    Asn-322     Uromodulin / Homo sapiens
• QDFNITDISLLEHR (14aa)
  •    P07911    Asn-322     Uromodulin / Homo sapiens
• SCPACPGSNITIR (13aa)
  •    P05164    Asn-323     Myeloperoxidase / Homo sapiens
  •    P05164    Ser-322     Myeloperoxidase / Homo sapiens
• MFSQNDTR (8aa)
  •    P02750    Asn-325     Leucine-rich alpha-2-glycoprotein / Homo sapiens
• SHCIAEVENDEMPADLPSLAADFVESKDVCK (31aa)
  •    P02768    Ser-328     Serum albumin / Homo sapiens
• NETQHEPYPLMLPGCSPSCPLER (23aa)
  •    P15309    Asn-333     Prostatic acid phosphatase / Homo sapiens
• LPTTVLNATAK (11aa)
  •    Q9GZM5    Asn-337     Protein YIPF3 / Homo sapiens
• AVAVTLQSH (9aa)
  •    Q9GZM5    Ser-349     Protein YIPF3 / Homo sapiens
  •    Q9GZM5    Thr-346     Protein YIPF3 / Homo sapiens
• SLTVSLGPVSKTEGFPK (17aa)
  •    Q9ULI3    Thr-356     Protein heg homolog 1 / Homo sapiens
  •    Q9ULI3    Ser-349     Protein heg homolog 1 / Homo sapiens
• NHGVDDDGDDDGDDGGTDGPR (21aa)
  •    Q14515    Thr-350     Sparc-like protein 1 / Homo sapiens
• AGLQAFFQVQECNK (14aa)
  •    P00450    Asn-358     Ceruloplasmin / Homo sapiens
• AGLQAFFQVQECNKSSSK (18aa)
  •    P00450    Ser-360     Ceruloplasmin / Homo sapiens
• LANLTQGEDQYYLR (14aa)
  •    P10909    Asn-374     Clusterin / Homo sapiens
• VGPVRPTGQDWNHTPQK (17aa)
  •    P09603    Thr-376     Macrophage colony-stimulating factor 1 / Homo sapiens
• ALLPFDNLHDDPCLLTNR (18aa)
  •    P05164    Asn-391     Myeloperoxidase / Homo sapiens
• ALLPFDNLHDDPCLLTNRSAR (21aa)
  •    P05164    Asn-391     Myeloperoxidase / Homo sapiens
• ENLTAPGSDSAVFFEQGTTR (20aa)
  •    P00450    Asn-397     Ceruloplasmin / Homo sapiens
• LNDTTLQVLNTWYTK (15aa)
  •    Q6UX06    Asn-411     Olfactomedin-4 / Homo sapiens
• LSLLEEPGNGTFTVILNQLTSR (22aa)
  •    P01833    Asn-421     Polymeric immunoglobulin receptor / Homo sapiens
• CGLVPVLAENYNK (13aa)
  •    P02787    Asn-432     Serotransferrin / Homo sapiens
• CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa)
  •    P02787    Asn-432     Serotransferrin / Homo sapiens
  •    VAR_058199   448:I→V   dbSNP:rs2692696
• CGLVPVLAENYKSQQSSDPDPNCVDR (26aa)
  •    P02788    Ser-436     Lactotransferrin / Homo sapiens
• ALPQPQNVTSLLGCTH (16aa)
  •    P02790    Asn-453     Hemopexin / Homo sapiens
• ALPQPQNVTSLLGCT (15aa)
  •    P02790    Asn-453     Hemopexin / Homo sapiens
• VPGNVTAVLGETLK (14aa)
  •    P01833    Asn-469     Polymeric immunoglobulin receptor / Homo sapiens
• SYNDSVDPR (9aa)
  •    P05164    Asn-483     Myeloperoxidase / Homo sapiens
  •    P05164    Ser-481     Myeloperoxidase / Homo sapiens
• TAGWNIPMGLLFNQTGSCK (19aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• WNNTGCQALPSQDEGPSK (18aa)
  •    P01833    Asn-499     Polymeric immunoglobulin receptor / Homo sapiens
• FALLMTNCYATPSSNATDPLKYFIIQDR (28aa)
  •    P07911    Asn-513     Uromodulin / Homo sapiens
  •    P07911    Thr-504     Uromodulin / Homo sapiens
  •    P07911    Ser-512     Uromodulin / Homo sapiens
  •    P07911    Ser-511     Uromodulin / Homo sapiens
• FALLMTNCYATPSSNATDPLK (21aa)
  •    P07911    Asn-513     Uromodulin / Homo sapiens
  •    P07911    Ser-512     Uromodulin / Homo sapiens
  •    P07911    Ser-511     Uromodulin / Homo sapiens
• SQIQTPNPNQDQWSGQNAK (19aa)
  •    Q02383    Ser-519     Semenogelin-2 / Homo sapiens
• DQCIVDDITYNVNDTFHK (18aa)
  •    P02751    Asn-528     Fibronectin / Homo sapiens
• DVECGEGHFCHDNQTCCR (18aa)
  •    P28799    Thr-532     Progranulin / Homo sapiens
  •    P28799    Asn-530     Progranulin / Homo sapiens
• GQGEQGSTGGTNISSTSEPKEE (22aa)
  •    Q16610    Thr-534     Extracellular matrix protein 1 / Homo sapiens
• EPPPRTLPATDLQ (13aa)
  •    Q96PD5    Thr-569     N-acetylmuramoyl-l-alanine amidase / Homo sapiens
• NQALNLSLAYSFVTPLTSMVVTK (23aa)
  •    Q14624    Asn-577     Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
• MAEVIGSKLNISR (13aa)
  •    Q9NU22    Asn-602     Midasin / Homo sapiens
• AVADTRDQADGSR (13aa)
  •    P01833    Thr-614     Polymeric immunoglobulin receptor / Homo sapiens
• AVADTRDQADGSRASVDSGSSEEQGGSSR (29aa)
  •    P01833    Ser-624     Polymeric immunoglobulin receptor / Homo sapiens
• ASVDSGSSEEQGGSSR (16aa)
  •    P01833    Ser-624     Polymeric immunoglobulin receptor / Homo sapiens
• QQQHLFGSNVTDCSGNFCLFR (21aa)
  •    P02787    Asn-630     Serotransferrin / Homo sapiens
• DQADGSRASVDSGSSEEQGGSSR (23aa)
  •    P01833    Ser-627     Polymeric immunoglobulin receptor / Homo sapiens
  •    P01833    Ser-621     Polymeric immunoglobulin receptor / Homo sapiens
  •    P01833    Ser-630     Polymeric immunoglobulin receptor / Homo sapiens
• TVYLYPNQTGLPDPLSR (17aa)
  •    P16112    Asn-658     Aggrecan core protein / Homo sapiens
• VVPDSTPSWANPSPTPVISMLAQGSQVLESTPPPHVMR (38aa)
  •    P19823    Thr-675     Inter-alpha-trypsin inhibitor heavy chain h2 / Homo sapiens
• LAILPASATPATSNPDPAVSR (21aa)
  •    Q14624    Ser-709     Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
• IEETTMTTQTPAPIQAPSAILPLPGQSVER (30aa)
  •    Q14624    Ser-733     Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •    Q14624    Thr-725     Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
• VLGPKDSK (8aa)
  •    Q7RTY7    Ser-965     Ovochymase-1 / Homo sapiens
• DPQRFVVIQNEDLGPASPLDSTFYR (25aa)
  •    P04626    Ser-998     Receptor tyrosine-protein kinase erbB-2 / Homo sapiens
• LDAPTNLQFVNETDSTVLVR (20aa)
  •    P02751    Asn-1007     Fibronectin / Homo sapiens
• NYYADNQTCDGELLFNMTK (19aa)
  •    P35555    Asn-1713     Fibrillin-1 / Homo sapiens
• TAIFAFNISHVSNK (14aa)
  •    P35555    Asn-2767     Fibrillin-1 / Homo sapiens
• GQDSTIAASEQQVAAR (16aa)
  •    P13611    Ser-3024     Versican core protein / Homo sapiens
• QSGDVTCNCTDGR (13aa)
  •    Q07954    Asn-4364     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
  •    Q07954    Thr-4362     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens