taxonomy (4)
protein (138)
source (1)
structure (339)
composition (368)
disease (21)
reference (48)
site (264)
peptide (200)
- Homo sapiens (Human)
- Felis catus (Cat)
- Mus musculus (House mouse)
- Rattus norvegicus (Norway rat)
Taxonomy
- 3-O-beta-D-glucopyranosyl-alpha-L-fucopyranosyl-L-threonine / Homo sapiens
- A disintegrin and metalloproteinase with thrombospondin motifs 5 / Homo sapiens Q9UNA0
- Afamin / Homo sapiens P43652
- Aggrecan core protein / Homo sapiens P16112
- Alpha-1-acid glycoprotein 1 / Homo sapiens P02763
- Alpha-1-acid glycoprotein 2 / Homo sapiens P19652
- Alpha-1-antichymotrypsin / Homo sapiens P01011
- Alpha-1-antitrypsin / Homo sapiens P01009
- Alpha-2-HS-glycoprotein / Homo sapiens P02765
- Angiopoietin-related protein 3 / Homo sapiens Q9Y5C1
- Antithrombin-III / Homo sapiens P01008
- Apolipoprotein C-III / Homo sapiens P02656
- Apolipoprotein D / Homo sapiens P05090
- Apolipoprotein F / Homo sapiens Q13790
- Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens P98160
- Beta-2-glycoprotein 1 / Homo sapiens P02749
- Beta-defensin 1 / Homo sapiens P60022
- C-C motif chemokine 24 / Homo sapiens O00175
- Carboxypeptidase b2 / Homo sapiens Q96IY4
- CD27 antigen / Homo sapiens P26842
- CD44 antigen / Homo sapiens P16070
- CD59 glycoprotein / Homo sapiens P13987
- CD99 antigen / Homo sapiens P14209
- Cell adhesion molecule 1 / Homo sapiens Q9BY67
- Ceruloplasmin / Homo sapiens P00450
- Choriogonadotropin - alpha and beta chains / Homo sapiens P01215 P0DN86
- Choriogonadotropin beta chain / Homo sapiens P0DN86
- Chromogranin a / Homo sapiens P10645
- Clusterin / Homo sapiens P10909
- Collagen alpha-1(xv) chain / Homo sapiens P39059
- Complement C1r subcomponent-like protein / Homo sapiens Q9NZP8
- Complement C4-B / Homo sapiens P0C0L5
- Complement component c7 / Homo sapiens P10643
- Complement factor i / Homo sapiens P05156
- Corticosteroid-binding globulin / Homo sapiens P08185
- Cyclic amp-responsive element-binding protein 3-like protein 3 / Homo sapiens Q68CJ9
- Deoxyribonuclease-1 / Homo sapiens P24855
- Disintegrin and metalloproteinase domain-containing protein 8 / Homo sapiens P78325
- Ecto-ADP-ribosyltransferase 3 / Homo sapiens Q13508
- Ecto-adp-ribosyltransferase 3 / Homo sapiens Q13508
- Erythropoietin / Homo sapiens P01588
- Extracellular matrix protein 1 / Homo sapiens Q16610
- Extracellular sulfatase Sulf-2 / Homo sapiens Q8IWU5
- Fibrillin-1 / Homo sapiens P35555
- Fibrinogen gamma chain / Homo sapiens P02679
- Fibroblast growth factor receptor 2 / Homo sapiens P21802
- Fibronectin / Homo sapiens P02751
- Fibronectin type III domain-containing protein 4 / Homo sapiens Q9H6D8
- Fractalkine / Homo sapiens P78423
- Frizzled-4 / Homo sapiens Q9ULV1
- Glandular kallikrein 1 / Homo sapiens P06870
- Glycophorin a, b and c / Homo sapiens P02724 P04921 P06028
- Glycophorin-A / Homo sapiens P02724
- Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens P01215
- Haptoglobin / Homo sapiens P00738
- Hemopexin / Homo sapiens P02790
- Hepatitis a virus cellular receptor 2 / Homo sapiens Q8TDQ0
- HLA class II histocompatibility antigen gamma chain / Homo sapiens P04233
- Icos ligand / Homo sapiens O75144
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant gamma 1 / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Immunoglobulin J chain / Homo sapiens P01591
- Immunoglobulin lambda-1 light chain / Homo sapiens P0DOX8
- Insulin-like growth factor II / Homo sapiens P01344
- Insulin-like growth factor-binding protein 6 / Homo sapiens P24592
- Inter-alpha-trypsin inhibitor heavy chain h2 / Homo sapiens P19823
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens Q14624
- Interleukin-18-binding protein / Homo sapiens O95998
- Kallistatin / Homo sapiens P29622
- Kininogen-1 / Homo sapiens P01042
- Lactotransferrin / Homo sapiens P02788
- Leucine-rich alpha-2-glycoprotein / Homo sapiens P02750
- Leukocyte-associated immunoglobulin-like receptor 1 / Homo sapiens Q6GTX8
- Lymphatic vessel endothelial hyaluronic acid receptor 1 / Homo sapiens Q9Y5Y7
- Lysosomal acid phosphatase / Homo sapiens P11117
- Macrophage colony-stimulating factor 1 / Homo sapiens P09603
- Membrane protein FAM174A / Homo sapiens Q8TBP5
- Metalloproteinase inhibitor 1 / Homo sapiens P01033
- Microfibrillar-associated protein 5 / Homo sapiens Q13361
- Midasin / Homo sapiens Q9NU22
- Mucin-1 / Homo sapiens P15941
- Multimerin-1 / Homo sapiens Q13201
- Myeloperoxidase / Homo sapiens P05164
- N-acetylmuramoyl-l-alanine amidase / Homo sapiens Q96PD5
- Neuroblastoma suppressor of tumorigenicity 1 / Homo sapiens P41271
- Non-secretory ribonuclease / Homo sapiens P10153
- Olfactomedin-4 / Homo sapiens Q6UX06
- Osteopontin / Homo sapiens P10451
- Ovochymase-1 / Homo sapiens Q7RTY7
- Phosphoinositide-3-kinase-interacting protein 1 / Homo sapiens Q96FE7
- Plasma protease c1 inhibitor / Homo sapiens P05155
- Plasma serine protease inhibitor / Homo sapiens P05154
- Poliovirus receptor / Homo sapiens P15151
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Progranulin / Homo sapiens P28799
- Proheparin-binding EGF-like growth factor / Homo sapiens Q99075
- Prolactin-inducible protein / Homo sapiens P12273
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens Q07954
- Prosaas / Homo sapiens Q9UHG2
- Prosaposin / Homo sapiens P07602
- Prostaglandin-h2 d-isomerase / Homo sapiens P41222
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Prostatic acid phosphatase / Homo sapiens P15309
- Protein AMBP / Homo sapiens P02760
- Protein delta homolog 1 / Homo sapiens P80370
- Protein heg homolog 1 / Homo sapiens Q9ULI3
- Protein YIPF3 / Homo sapiens Q9GZM5
- Protein-lysine 6-oxidase / Homo sapiens P28300
- Prothrombin / Homo sapiens P00734
- Receptor tyrosine-protein kinase erbB-2 / Homo sapiens P04626
- Receptor-type tyrosine-protein phosphatase-like n / Homo sapiens Q16849
- Roundabout homolog 4 / Homo sapiens Q8WZ75
- Semenogelin-2 / Homo sapiens Q02383
- Serotransferrin / Homo sapiens P02787
- Serum albumin / Homo sapiens P02768
- Small integral membrane protein 3 / Homo sapiens Q9BZL3
- Sparc-like protein 1 / Homo sapiens Q14515
- Syndecan-2 / Homo sapiens P34741
- Thrombomodulin / Homo sapiens P07204
- Thyroxine-binding globulin / Homo sapiens P05543
- Transmembrane protease serine 2 / Homo sapiens O15393
- Transmembrane protein C16orf54 / Homo sapiens Q6UWD8
- Tumor necrosis factor receptor superfamily member 6 / Homo sapiens P25445
- Tyrosine-protein kinase receptor UFO / Homo sapiens P30530
- Uncharacterized protein from Urine / Homo sapiens
- Uncharacterized protein from Urine / Homo sapiens
- Urine glycopeptide / Homo sapiens
- Urokinase-type plasminogen activator / Homo sapiens P00749
- Uromodulin / Homo sapiens P07911
- Vasorin / Homo sapiens Q6EMK4
- Versican core protein / Homo sapiens P13611
- Vitamin k-dependent protein c / Homo sapiens P04070
- WAP four-disulfide core domain protein 2 / Homo sapiens Q14508
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Major urinary protein / Mus musculus
Protein
- Urine (UBERON_0001088)
Source
- C-Linked / Undefined core / Man
- Free / Lactosamine / Neu5,9Ac2(a2-6)Gal(b1-4)GlcNAc
- Free / Lactosamine / NeuAc(a2-3)Gal(b1-3)GlcNAc(a1-P)
- Free / Lactosamine / NeuAc(a2-3)Gal(b1-4)GlcNAc(a1-P)
- Free / Lactosamine / NeuAc(a2-6)Gal(b1-4)GlcNAc(a1-P)
- Free / Lactose / Fuc(a1-2)Gal(b1-4)Glc
- Free / Lactose / NeuAc(a2-3)Gal(b1-4)Glc
- Free / Lactose / NeuAc(a2-6)Gal(b1-4)Glc
- Free / Lactose / Neu5,9Ac2(a2-3)Gal(b1-4)Glc
- Free / No-core / NeuAc
- Free / No-core / Man(b1-4)GlcNAc
- Free / No-core / NeuAc(a2-3)Man(b1-4)Glc
- Free / No-core / NeuAc(a2-6)Man(b1-4)GlcNAc
- Free / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-3)Man(b1-4)GlcNAc
- Free / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc
- Free / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-4)Man(a1-3)Man(b1-4)GlcNAc
- Free / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-4)Man(a1-6)Man(b1-4)GlcNAc
- Free / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-3)[Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc
- Free / Truncated / Fuc(a1-6)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc
- N-Linked / Complex / Fuc(a1-3)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Fuc(a1-3)GlcNAc(b1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 10703
- N-Linked / Complex / Structure 10827
- N-Linked / Complex / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-3)GlcNAc(b1-2)Man(a1-3)[Gal(b1-3)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-3)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 10704
- N-Linked / Complex / Structure 10714
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc
- N-Linked / Complex / Structure 10779
- N-Linked / Complex / Structure 10784
- N-Linked / Complex / Structure 10696
- N-Linked / Complex / Structure 10729
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10711
- N-Linked / Complex / Structure 10834
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10788
- N-Linked / Complex / Structure 10764
- N-Linked / Complex / Structure 10778
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-?)GlcNAc(b1-2)Man(a1-?)[Gal(b1-?)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 10246
- N-Linked / Complex / Structure 10688
- N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[HSO3(-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10691
- N-Linked / Complex / Structure 10830
- N-Linked / Complex / Gal(b1-3)GlcNAc(b1-2)[Gal(b1-3)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-3)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-3)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-3)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-3)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 10726
- N-Linked / Complex / Fuc(a1-3)[GalNAc(b1-4)]GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Fuc(a1-3)[GalNAc(b1-4)]GlcNAc(b1-2)Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc
- N-Linked / Complex / HSO3(-4)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[HSO3(-4)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / HSO3(-4)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 10763
- N-Linked / Complex / Structure 10809
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10186
- N-Linked / Complex / Structure 10767
- N-Linked / Complex / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-6)[Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-6)[Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-4)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc+"+ NeuAc"
- N-Linked / Complex / Structure 10697
- N-Linked / Complex / Structure 10776
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10698
- N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-2)[HSO3(-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / HSO3(-4)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10780
- N-Linked / Complex / Structure 10800
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-?)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-6)Gal(b1-?)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 10303
- N-Linked / Complex / Structure 10758
- N-Linked / Complex / Structure 10836
- N-Linked / Complex / Structure 10695
- N-Linked / Complex / Structure 10722
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[GalNAc(b1-4)GlcNAc(b1-6)]Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10702
- N-Linked / Complex / Structure 10732
- N-Linked / Complex / Structure 10782
- N-Linked / Complex / Structure 10798
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)[GalNAc(b1-4)GlcNAc(b1-6)]Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10716
- N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-2)[HSO3(-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Neu?c(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Neu?c(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10713
- N-Linked / Complex / Structure 10744
- N-Linked / Complex / Structure 10765
- N-Linked / Complex / Gal(b1-3)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc+"+ 2 x NeuAc"
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc
- N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-2)[HSO3(-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[HSO3(-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[HSO3(-4)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10710
- N-Linked / Complex / Structure 10810
- N-Linked / Complex / Structure 10826
- N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-2)[HSO3(-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)[NeuAc(a2-3)]GlcNAc(b1-2)Man(a1-?)[NeuAc(a2-6)Gal(b1-?)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-3)GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-4)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-6)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-2)[HSO3(-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[HSO3(-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)[GalNAc(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10690
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3) + 2 x NeuAc"
- N-Linked / Complex / GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-4)[HSO3(-3)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[HSO3(-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 10724
- N-Linked / Complex / Structure 10760
- N-Linked / Complex / Structure 10769
- N-Linked / Complex / Structure 10789
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3)"
- N-Linked / Complex / GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-4)[HSO3(-3)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10731
- N-Linked / Complex / Structure 10743
- N-Linked / Complex / Structure 10746
- N-Linked / Complex / Structure 10828
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc+"+ Gal(b1-2)GlcNAc(b1-3) + 3 x NeuAc"
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-?)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)]Man(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-?)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-?)]Man(a1-?)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc
- N-Linked / Complex / GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-6)[HSO3(-3)Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[HSO3(-3)Gal(b1-4)GlcNAc(b1-2)[HSO3(-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-2)[HSO3(-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc+"+ 2 x Gal(b1-4)GlcNAc(b1-3) + 2 x NeuAc"
- N-Linked / Complex / GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-4)[HSO3(-3)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x Gal(b1-4)GlcNAc(b1-3)"
- N-Linked / Complex / GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-6)[HSO3(-3)Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[HSO3(-3)Gal(b1-4)GlcNAc(b1-2)[HSO3(-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-2)[HSO3(-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ HSO3(-3) + 3 x NeuAc(a2-3)"
- N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)]Man(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)]Man(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc+"+ 2 x Gal(b1-4)GlcNAc(b1-3) + 3 x NeuAc"
- N-Linked / Complex / GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[HSO3(-3)Gal(b1-4)GlcNAc(b1-2)[HSO3(-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / HSO3(-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-2)[GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[HSO3(-3)Gal(b1-4)GlcNAc(b1-2)[HSO3(-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-2)[GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[HSO3(-3)Gal(b1-4)GlcNAc(b1-2)[HSO3(-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[HSO3(-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-2)[GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-2)[GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-2)[GalNAc(b1-4)[NeuAc(a2-3)]Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Structure 10819
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Man"
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Structure 10092
- N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-?)[Man(a1-?)]Man(a1-6)[Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 10699
- N-Linked / Hybrid / Structure 10802
- N-Linked / Hybrid / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 10739
- N-Linked / Hybrid / Structure 10814
- N-Linked / Hybrid / Structure 10730
- N-Linked / No-core / Fuc(a1-6)[Gal(b1-4)]GlcNAc
- N-Linked / No-core / Man(a1-3)Man(b1-4)GlcNAc
- N-Linked / No-core / Man(a1-6)Man(b1-4)GlcNAc
- N-Linked / No-core / NeuAc(a2-3)Gal(b1-4)GlcNAc
- N-Linked / No-core / NeuAc(a2-6)Gal(b1-4)GlcNAc
- N-Linked / No-core / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc
- N-Linked / No-core / Man(a1-3)Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / No-core / Man(a1-6)Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / No-core / Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / NeuAc(a2-8)NeuAc(a2-3)Gal(b1-4)GlcNAc
- N-Linked / No-core / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc
- N-Linked / No-core / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc
- N-Linked / No-core / Gal(b1-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc
- N-Linked / No-core / Man(a1-2)Man(a1-6)Man(a1-6)Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / No-core / Man(a1-3)[Man(a1-6)]Man(a1-6)Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / No-core / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)Man(b1-4)GlcNAc
- N-Linked / No-core / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc
- N-Linked / No-core / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)Man(b1-4)GlcNAc
- N-Linked / No-core / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc
- N-Linked / No-core / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)Man(b1-4)GlcNAc
- N-Linked / No-core / Fuc(a1-3)GlcNAc(b1-2)Man(a1-3)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Fuc(a1-3)GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Gal(b1-4)GlcNAc(b1-4)Man(a1-3)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Gal(b1-4)GlcNAc(b1-6)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)Man(b1-4)GlcNAc
- N-Linked / No-core / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-4)Man(a1-3)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-3)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-4)Man(a1-3)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]Man(a1-3)Man(b1-4)GlcNAc
- N-Linked / No-core / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)Man(b1-4)GlcNAc
- N-Linked / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)[Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-6)]Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- O-Linked / Core 0 / GalNAc
- O-Linked / Core 0 / NeuAc(a2-6)GalNAc
- O-Linked / Core 1 / Gal(b1-3)GalNAc
- O-Linked / Core 1 / Gal(b1-3)[NeuAc(a2-6)]GalNAc
- O-Linked / Core 1 / NeuAc(a2-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Structure 9458
- O-Linked / Core 1 / Neu5Ac(?2-?)Gal(b1-3)[Neu5Ac(?2-?)]GalNAc(a1-
- O-Linked / Core 1 / NeuAc(?2-6)Gal(b1-3)[NeuAc(a2-6)]GalNAc
- O-Linked / Core 1 / NeuAc(a2-3)Gal(b1-3)[NeuAc(a2-6)]GalNAc
- O-Linked / Core 1 / Structure 9323
- O-Linked / Core 1 / Structure 9311
- O-Linked / Core 1 / Structure 9242
- O-Linked / Core 1 / Structure 9345
- O-Linked / Core 1 / Structure 9295
- O-Linked / Core 1 / Structure 9335
- O-Linked / Core 2 / Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / NeuAc(a2-6)Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc+"+ NeuAc(a2-3)"
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / NeuAc(?2-?)Gal(?1-?)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Structure 9364
- O-Linked / Core 2 / Structure 9504
- O-Linked / Core 2 / Structure 9519
- O-Linked / Core 2 / NeuAc(?2-?)Gal(?1-?)GlcNAc(b1-6)[NeuAc(?2-?)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Structure 9362
- O-Linked / Core 2 / Structure 9322
- O-Linked / Core 2 / Structure 9351
- O-Linked / Core 2 / Structure 9359
- O-Linked / Core 2 / Structure 9432
- O-Linked / Core 2 / Structure 9518
- O-Linked / Core 2 / Structure 9413
- O-Linked / Core 2 / Structure 9435
- O-Linked / Core 2 / Structure 9253
- O-Linked / Core 2 / Structure 9366
- O-Linked / Core 2 / Structure 9361
- O-Linked / Core 2 / Structure 9365
- O-Linked / Core 2 / Structure 9530
- O-Linked / Core 2 / Structure 9360
- O-Linked / Core 2 / Structure 9383
- O-Linked / Core 2 / Structure 9382
- O-Linked / Core 2 / Structure 9387
- O-Linked / Core 2 / Structure 9391
- O-Linked / Core 2 / Structure 9467
- O-Linked / Core 2 / Structure 9363
- O-Linked / Core 2 / Structure 9436
- O-Linked / Core 2 / Structure 9543
- O-Linked / Core 2 / Structure 9528
- O-Linked / Core 2 / Structure 9369
- O-Linked / Core 2 / Structure 9479
- O-Linked / Core 2 / Structure 9434
- O-Linked / Core 3 / Structure 9358
- O-Linked / No-core / Glc(b1-3)Fuc
- O-Linked / No-core / HSO3(-3)GlcA(b1-3)Gal(b1-3)Gal(b1-4)Xyl
- O-Linked / No-core / HSO3(-3)GlcA(b1-3)Gal(b1-3)[NeuAc(a2-6)]Gal(b1-4)Xyl
- O-Linked / O-Fuc / Fuc
- O-Linked / Undefined core / NeuAc(?2-?)Gal(?1-?)GalNAc(?1-?)GalNAc
Reported structure
- NeuAc:1 (avg mass : 309.2732 )
- dHex:1 (avg mass : 164.1583 )
- HexNAc:1 (avg mass : 221.2103 )
- HexNAc:1 NeuAc:1 (avg mass : 512.4682 )
- HexNAc:1 dHex:1 (avg mass : 367.3533 )
- HexNAc:2 (avg mass : 424.4053 )
- HexNAc:2 NeuAc:1 (avg mass : 715.6632 )
- HexNAc:2 dHex:1 (avg mass : 570.5483 )
- HexNAc:3 dHex:1 (avg mass : 773.7433 )
- Hex:1 (avg mass : 180.1577 )
- Hex:1 dHex:1 (avg mass : 326.3007 )
- Hex:1 HexNAc:1 (avg mass : 383.3527 )
- Hex:1 HexNAc:1 Su:1 (avg mass : 463.4169 )
- Hex:1 HexNAc:1 NeuAc:1 (avg mass : 674.6106 )
- Hex:1 HexNAc:1 NeuAc:1 Ac:1 (avg mass : 716.6473 )
- Hex:1 HexNAc:1 NeuAc:1 Ph:1 (avg mass : 754.5905 )
- Hex:1 HexNAc:1 NeuAc:1 NeuGc:1 (avg mass : 981.8679 )
- Hex:1 HexNAc:1 NeuAc:2 (avg mass : 965.8685 )
- Hex:1 HexNAc:1 NeuAc:2 Ac:1 (avg mass : 1007.9052 )
- Hex:1 HexNAc:1 NeuAc:2 Ac:2 (avg mass : 1049.9419 )
- Hex:1 HexNAc:1 NeuAc:3 (avg mass : 1257.1264 )
- Hex:1 HexNAc:1 NeuAc:3 Ac:1 (avg mass : 1299.1631 )
- Hex:1 HexNAc:1 NeuAc:3 Ac:2 (avg mass : 1341.1998 )
- Hex:1 HexNAc:1 NeuAc:3 Ac:3 (avg mass : 1383.2365 )
- Hex:1 HexNAc:1 dHex:1 (avg mass : 529.4957 )
- Hex:1 HexNAc:1 dHex:1 NeuAc:1 (avg mass : 820.7536 )
- Hex:1 HexNAc:2 (avg mass : 586.5477 )
- Hex:1 HexNAc:2 NeuAc:1 (avg mass : 877.8056 )
- Hex:1 HexNAc:2 dHex:1 (avg mass : 732.6907 )
- Hex:1 HexNAc:2 dHex:1 NeuAc:1 (avg mass : 1023.9486 )
- Hex:1 HexNAc:2 dHex:2 (avg mass : 878.8337 )
- Hex:1 HexNAc:3 (avg mass : 789.7427 )
- Hex:1 HexNAc:3 NeuAc:1 (avg mass : 1081.0006 )
- Hex:1 HexNAc:3 dHex:1 (avg mass : 935.8857 )
- Hex:1 HexNAc:4 (avg mass : 992.9377 )
- Hex:1 HexNAc:4 dHex:1 (avg mass : 1139.0807 )
- Hex:2 Pent:1 Su:1 HexA:1 (avg mass : 730.6063 )
- Hex:2 NeuAc:1 (avg mass : 633.558 )
- Hex:2 NeuAc:1 Ac:1 (avg mass : 675.5947 )
- Hex:2 NeuAc:1 Pent:1 Su:1 HexA:1 (avg mass : 1021.8642 )
- Hex:2 dHex:1 (avg mass : 488.4431 )
- Hex:2 HexNAc:1 (avg mass : 545.4951 )
- Hex:2 HexNAc:2 (avg mass : 748.6901 )
- Hex:2 HexNAc:2 NeuAc:1 (avg mass : 1039.948 )
- Hex:2 HexNAc:2 NeuAc:2 (avg mass : 1331.2059 )
- Hex:2 HexNAc:2 NeuAc:2 Ac:1 (avg mass : 1373.2426 )
- Hex:2 HexNAc:2 NeuAc:2 Ac:2 (avg mass : 1415.2793 )
- Hex:2 HexNAc:2 NeuAc:2 Su:1 (avg mass : 1411.2701 )
- Hex:2 HexNAc:2 NeuAc:3 Ac:1 (avg mass : 1664.5005 )
- Hex:2 HexNAc:2 NeuAc:3 Ac:2 (avg mass : 1706.5372 )
- Hex:2 HexNAc:2 dHex:1 (avg mass : 894.8331 )
- Hex:2 HexNAc:2 dHex:1 NeuAc:1 (avg mass : 1186.091 )
- Hex:2 HexNAc:2 dHex:1 NeuAc:2 (avg mass : 1477.3489 )
- Hex:2 HexNAc:2 dHex:1 NeuAc:2 Ac:1 (avg mass : 1519.3856 )
- Hex:2 HexNAc:2 dHex:1 NeuAc:2 Ac:2 (avg mass : 1561.4223 )
- Hex:2 HexNAc:2 dHex:2 (avg mass : 1040.9761 )
- Hex:2 HexNAc:2 dHex:2 NeuAc:1 (avg mass : 1332.234 )
- Hex:2 HexNAc:2 dHex:3 (avg mass : 1187.1191 )
- Hex:2 HexNAc:3 NeuAc:1 (avg mass : 1243.143 )
- Hex:2 HexNAc:3 NeuAc:2 (avg mass : 1534.4009 )
- Hex:2 HexNAc:3 dHex:1 (avg mass : 1098.0281 )
- Hex:2 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 1389.286 )
- Hex:2 HexNAc:3 dHex:2 (avg mass : 1244.1711 )
- Hex:2 HexNAc:4 (avg mass : 1155.0801 )
- Hex:2 HexNAc:4 dHex:2 (avg mass : 1447.3661 )
- Hex:3 HexNAc:1 (avg mass : 707.6375 )
- Hex:3 HexNAc:2 (avg mass : 910.8325 )
- Hex:3 HexNAc:2 NeuAc:1 (avg mass : 1202.0904 )
- Hex:3 HexNAc:2 dHex:1 (avg mass : 1056.9755 )
- Hex:3 HexNAc:2 dHex:1 NeuAc:1 (avg mass : 1348.2334 )
- Hex:3 HexNAc:3 (avg mass : 1114.0275 )
- Hex:3 HexNAc:3 NeuAc:1 (avg mass : 1405.2854 )
- Hex:3 HexNAc:3 NeuAc:2 (avg mass : 1696.5433 )
- Hex:3 HexNAc:3 dHex:1 (avg mass : 1260.1705 )
- Hex:3 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 1551.4284 )
- Hex:3 HexNAc:3 dHex:1 NeuAc:2 (avg mass : 1842.6863 )
- Hex:3 HexNAc:3 dHex:2 (avg mass : 1406.3135 )
- Hex:3 HexNAc:3 dHex:2 NeuAc:2 (avg mass : 1988.8293 )
- Hex:3 HexNAc:4 (avg mass : 1317.2225 )
- Hex:3 HexNAc:4 NeuGc:1 (avg mass : 1624.4798 )
- Hex:3 HexNAc:4 NeuAc:1 (avg mass : 1608.4804 )
- Hex:3 HexNAc:4 dHex:1 (avg mass : 1463.3655 )
- Hex:3 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 1754.6234 )
- Hex:3 HexNAc:4 dHex:2 (avg mass : 1609.5085 )
- Hex:3 HexNAc:5 (avg mass : 1520.4175 )
- Hex:3 HexNAc:5 NeuAc:1 (avg mass : 1811.6754 )
- Hex:3 HexNAc:5 dHex:1 (avg mass : 1666.5605 )
- Hex:3 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 1957.8184 )
- Hex:3 HexNAc:6 (avg mass : 1723.6125 )
- Hex:3 HexNAc:6 NeuAc:1 (avg mass : 2014.8704 )
- Hex:3 HexNAc:6 NeuAc:2 (avg mass : 2306.1283 )
- Hex:3 HexNAc:6 dHex:1 (avg mass : 1869.7555 )
- Hex:3 HexNAc:6 dHex:1 Su:2 (avg mass : 2029.8839 )
- Hex:3 HexNAc:6 dHex:1 NeuGc:1 (avg mass : 2177.0128 )
- Hex:3 HexNAc:6 dHex:1 NeuGc:2 (avg mass : 2484.2701 )
- Hex:3 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2161.0134 )
- Hex:3 HexNAc:6 dHex:1 NeuAc:1 NeuGc:1 (avg mass : 2468.2707 )
- Hex:3 HexNAc:6 dHex:1 NeuAc:2 (avg mass : 2452.2713 )
- Hex:3 HexNAc:6 dHex:2 (avg mass : 2015.8985 )
- Hex:3 HexNAc:6 dHex:2 NeuGc:1 (avg mass : 2323.1558 )
- Hex:3 HexNAc:6 dHex:2 NeuAc:1 (avg mass : 2307.1564 )
- Hex:3 HexNAc:6 dHex:3 (avg mass : 2162.0415 )
- Hex:3 HexNAc:7 (avg mass : 1926.8075 )
- Hex:3 HexNAc:7 dHex:1 (avg mass : 2072.9505 )
- Hex:3 HexNAc:8 (avg mass : 2130.0025 )
- Hex:3 HexNAc:8 dHex:1 (avg mass : 2276.1455 )
- Hex:3 HexNAc:9 dHex:1 (avg mass : 2479.3405 )
- Hex:4 HexNAc:1 (avg mass : 869.7799 )
- Hex:4 HexNAc:2 (avg mass : 1072.9749 )
- Hex:4 HexNAc:2 NeuAc:1 (avg mass : 1364.2328 )
- Hex:4 HexNAc:3 (avg mass : 1276.1699 )
- Hex:4 HexNAc:3 NeuGc:1 (avg mass : 1583.4272 )
- Hex:4 HexNAc:3 NeuAc:1 (avg mass : 1567.4278 )
- Hex:4 HexNAc:3 NeuAc:2 (avg mass : 1858.6857 )
- Hex:4 HexNAc:3 dHex:1 (avg mass : 1422.3129 )
- Hex:4 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 1713.5708 )
- Hex:4 HexNAc:3 dHex:2 (avg mass : 1568.4559 )
- Hex:4 HexNAc:4 (avg mass : 1479.3649 )
- Hex:4 HexNAc:4 NeuGc:1 (avg mass : 1786.6222 )
- Hex:4 HexNAc:4 NeuAc:1 (avg mass : 1770.6228 )
- Hex:4 HexNAc:4 NeuAc:2 (avg mass : 2061.8807 )
- Hex:4 HexNAc:4 NeuAc:3 (avg mass : 2353.1386 )
- Hex:4 HexNAc:4 dHex:1 (avg mass : 1625.5079 )
- Hex:4 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 1916.7658 )
- Hex:4 HexNAc:4 dHex:2 (avg mass : 1771.6509 )
- Hex:4 HexNAc:4 dHex:2 NeuAc:1 (avg mass : 2062.9088 )
- Hex:4 HexNAc:4 dHex:3 (avg mass : 1917.7939 )
- Hex:4 HexNAc:4 dHex:3 NeuAc:1 (avg mass : 2209.0518 )
- Hex:4 HexNAc:5 (avg mass : 1682.5599 )
- Hex:4 HexNAc:5 NeuGc:1 (avg mass : 1989.8172 )
- Hex:4 HexNAc:5 NeuGc:2 (avg mass : 2297.0745 )
- Hex:4 HexNAc:5 NeuAc:1 (avg mass : 1973.8178 )
- Hex:4 HexNAc:5 NeuAc:1 Su:1 (avg mass : 2053.882 )
- Hex:4 HexNAc:5 NeuAc:1 NeuGc:1 (avg mass : 2281.0751 )
- Hex:4 HexNAc:5 NeuAc:2 (avg mass : 2265.0757 )
- Hex:4 HexNAc:5 dHex:1 (avg mass : 1828.7029 )
- Hex:4 HexNAc:5 dHex:1 Su:1 (avg mass : 1908.7671 )
- Hex:4 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2119.9608 )
- Hex:4 HexNAc:5 dHex:1 NeuAc:1 Su:1 (avg mass : 2200.025 )
- Hex:4 HexNAc:5 dHex:1 NeuAc:1 NeuGc:1 (avg mass : 2427.2181 )
- Hex:4 HexNAc:5 dHex:1 NeuAc:2 (avg mass : 2411.2187 )
- Hex:4 HexNAc:5 dHex:2 (avg mass : 1974.8459 )
- Hex:4 HexNAc:5 dHex:2 NeuAc:1 (avg mass : 2266.1038 )
- Hex:4 HexNAc:6 (avg mass : 1885.7549 )
- Hex:4 HexNAc:6 NeuAc:1 (avg mass : 2177.0128 )
- Hex:4 HexNAc:6 dHex:1 (avg mass : 2031.8979 )
- Hex:4 HexNAc:6 dHex:1 NeuAc:1 Su:1 (avg mass : 2403.22 )
- Hex:4 HexNAc:6 dHex:2 (avg mass : 2178.0409 )
- Hex:4 HexNAc:7 (avg mass : 2088.9499 )
- Hex:4 HexNAc:7 dHex:1 (avg mass : 2235.0929 )
- Hex:4 HexNAc:7 dHex:2 (avg mass : 2381.2359 )
- Hex:4 HexNAc:8 (avg mass : 2292.1449 )
- Hex:4 HexNAc:9 dHex:1 (avg mass : 2641.4829 )
- Hex:5 HexNAc:1 (avg mass : 1031.9223 )
- Hex:5 HexNAc:2 (avg mass : 1235.1173 )
- Hex:5 HexNAc:2 dHex:1 (avg mass : 1381.2603 )
- Hex:5 HexNAc:3 (avg mass : 1438.3123 )
- Hex:5 HexNAc:3 NeuGc:1 (avg mass : 1745.5696 )
- Hex:5 HexNAc:3 NeuAc:1 (avg mass : 1729.5702 )
- Hex:5 HexNAc:3 NeuAc:2 (avg mass : 2020.8281 )
- Hex:5 HexNAc:3 dHex:2 (avg mass : 1730.5983 )
- Hex:5 HexNAc:4 (avg mass : 1641.5073 )
- Hex:5 HexNAc:4 NeuGc:1 (avg mass : 1948.7646 )
- Hex:5 HexNAc:4 NeuGc:2 (avg mass : 2256.0219 )
- Hex:5 HexNAc:4 NeuAc:1 (avg mass : 1932.7652 )
- Hex:5 HexNAc:4 NeuAc:1 Su:1 (avg mass : 2012.8294 )
- Hex:5 HexNAc:4 NeuAc:1 NeuGc:1 (avg mass : 2240.0225 )
- Hex:5 HexNAc:4 NeuAc:2 (avg mass : 2224.0231 )
- Hex:5 HexNAc:4 NeuAc:3 (avg mass : 2515.281 )
- Hex:5 HexNAc:4 dHex:1 (avg mass : 1787.6503 )
- Hex:5 HexNAc:4 dHex:1 Su:2 (avg mass : 1947.7787 )
- Hex:5 HexNAc:4 dHex:1 NeuGc:1 (avg mass : 2094.9076 )
- Hex:5 HexNAc:4 dHex:1 NeuGc:2 (avg mass : 2402.1649 )
- Hex:5 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 2078.9082 )
- Hex:5 HexNAc:4 dHex:1 NeuAc:1 Su:1 (avg mass : 2158.9724 )
- Hex:5 HexNAc:4 dHex:1 NeuAc:1 NeuGc:1 (avg mass : 2386.1655 )
- Hex:5 HexNAc:4 dHex:1 NeuAc:2 (avg mass : 2370.1661 )
- Hex:5 HexNAc:4 dHex:2 (avg mass : 1933.7933 )
- Hex:5 HexNAc:4 dHex:2 NeuAc:1 (avg mass : 2225.0512 )
- Hex:5 HexNAc:4 dHex:3 (avg mass : 2079.9363 )
- Hex:5 HexNAc:4 dHex:3 NeuGc:2 (avg mass : 2694.4509 )
- Hex:5 HexNAc:4 dHex:3 NeuAc:1 (avg mass : 2371.1942 )
- Hex:5 HexNAc:4 dHex:3 NeuAc:1 NeuGc:1 (avg mass : 2678.4515 )
- Hex:5 HexNAc:4 dHex:3 NeuAc:2 (avg mass : 2662.4521 )
- Hex:5 HexNAc:5 (avg mass : 1844.7023 )
- Hex:5 HexNAc:5 NeuGc:1 (avg mass : 2151.9596 )
- Hex:5 HexNAc:5 NeuGc:2 (avg mass : 2459.2169 )
- Hex:5 HexNAc:5 NeuAc:1 (avg mass : 2135.9602 )
- Hex:5 HexNAc:5 NeuAc:1 NeuGc:1 (avg mass : 2443.2175 )
- Hex:5 HexNAc:5 NeuAc:2 (avg mass : 2427.2181 )
- Hex:5 HexNAc:5 dHex:1 (avg mass : 1990.8453 )
- Hex:5 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2282.1032 )
- Hex:5 HexNAc:5 dHex:1 NeuAc:1 NeuGc:1 (avg mass : 2589.3605 )
- Hex:5 HexNAc:5 dHex:1 NeuAc:2 (avg mass : 2573.3611 )
- Hex:5 HexNAc:5 dHex:2 (avg mass : 2136.9883 )
- Hex:5 HexNAc:5 dHex:2 NeuAc:1 (avg mass : 2428.2462 )
- Hex:5 HexNAc:5 dHex:3 (avg mass : 2283.1313 )
- Hex:5 HexNAc:6 (avg mass : 2047.8973 )
- Hex:5 HexNAc:6 dHex:1 (avg mass : 2194.0403 )
- Hex:5 HexNAc:6 dHex:1 NeuGc:3 (avg mass : 3115.8122 )
- Hex:5 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2485.2982 )
- Hex:5 HexNAc:6 dHex:1 NeuAc:1 NeuGc:1 (avg mass : 2792.5555 )
- Hex:5 HexNAc:6 dHex:1 NeuAc:2 (avg mass : 2776.5561 )
- Hex:5 HexNAc:6 dHex:1 NeuAc:2 NeuGc:1 (avg mass : 3083.8134 )
- Hex:5 HexNAc:6 dHex:1 NeuAc:3 (avg mass : 3067.814 )
- Hex:5 HexNAc:6 dHex:2 (avg mass : 2340.1833 )
- Hex:5 HexNAc:6 dHex:3 (avg mass : 2486.3263 )
- Hex:5 HexNAc:8 (avg mass : 2454.2873 )
- Hex:5 HexNAc:8 dHex:1 (avg mass : 2600.4303 )
- Hex:6 HexNAc:2 (avg mass : 1397.2597 )
- Hex:6 HexNAc:2 Ph:1 (avg mass : 1477.2396 )
- Hex:6 HexNAc:3 (avg mass : 1600.4547 )
- Hex:6 HexNAc:3 Ph:1 (avg mass : 1680.4346 )
- Hex:6 HexNAc:3 NeuGc:1 (avg mass : 1907.712 )
- Hex:6 HexNAc:3 NeuAc:1 (avg mass : 1891.7126 )
- Hex:6 HexNAc:3 dHex:1 NeuGc:1 (avg mass : 2053.855 )
- Hex:6 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 2037.8556 )
- Hex:6 HexNAc:3 dHex:1 NeuAc:2 (avg mass : 2329.1135 )
- Hex:6 HexNAc:4 (avg mass : 1803.6497 )
- Hex:6 HexNAc:4 NeuGc:1 (avg mass : 2110.907 )
- Hex:6 HexNAc:4 NeuAc:1 (avg mass : 2094.9076 )
- Hex:6 HexNAc:4 NeuAc:2 (avg mass : 2386.1655 )
- Hex:6 HexNAc:4 NeuAc:3 (avg mass : 2677.4234 )
- Hex:6 HexNAc:4 dHex:1 (avg mass : 1949.7927 )
- Hex:6 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 2241.0506 )
- Hex:6 HexNAc:4 dHex:2 (avg mass : 2095.9357 )
- Hex:6 HexNAc:4 dHex:3 (avg mass : 2242.0787 )
- Hex:6 HexNAc:5 (avg mass : 2006.8447 )
- Hex:6 HexNAc:5 Su:2 (avg mass : 2166.9731 )
- Hex:6 HexNAc:5 NeuGc:1 (avg mass : 2314.102 )
- Hex:6 HexNAc:5 NeuGc:2 (avg mass : 2621.3593 )
- Hex:6 HexNAc:5 NeuGc:3 (avg mass : 2928.6166 )
- Hex:6 HexNAc:5 NeuAc:1 (avg mass : 2298.1026 )
- Hex:6 HexNAc:5 NeuAc:1 Su:1 (avg mass : 2378.1668 )
- Hex:6 HexNAc:5 NeuAc:1 Su:2 (avg mass : 2458.231 )
- Hex:6 HexNAc:5 NeuAc:1 NeuGc:1 (avg mass : 2605.3599 )
- Hex:6 HexNAc:5 NeuAc:1 NeuGc:2 (avg mass : 2912.6172 )
- Hex:6 HexNAc:5 NeuAc:2 (avg mass : 2589.3605 )
- Hex:6 HexNAc:5 NeuAc:2 Su:1 (avg mass : 2669.4247 )
- Hex:6 HexNAc:5 NeuAc:2 NeuGc:1 (avg mass : 2896.6178 )
- Hex:6 HexNAc:5 NeuAc:3 (avg mass : 2880.6184 )
- Hex:6 HexNAc:5 dHex:1 (avg mass : 2152.9877 )
- Hex:6 HexNAc:5 dHex:1 Su:2 (avg mass : 2313.1161 )
- Hex:6 HexNAc:5 dHex:1 Su:3 (avg mass : 2393.1803 )
- Hex:6 HexNAc:5 dHex:1 NeuGc:1 (avg mass : 2460.245 )
- Hex:6 HexNAc:5 dHex:1 NeuGc:2 (avg mass : 2767.5023 )
- Hex:6 HexNAc:5 dHex:1 NeuGc:3 (avg mass : 3074.7596 )
- Hex:6 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2444.2456 )
- Hex:6 HexNAc:5 dHex:1 NeuAc:1 Su:2 (avg mass : 2604.374 )
- Hex:6 HexNAc:5 dHex:1 NeuAc:1 NeuGc:1 (avg mass : 2751.5029 )
- Hex:6 HexNAc:5 dHex:1 NeuAc:1 NeuGc:2 (avg mass : 3058.7602 )
- Hex:6 HexNAc:5 dHex:1 NeuAc:2 (avg mass : 2735.5035 )
- Hex:6 HexNAc:5 dHex:1 NeuAc:2 Su:1 (avg mass : 2815.5677 )
- Hex:6 HexNAc:5 dHex:1 NeuAc:2 NeuGc:1 (avg mass : 3042.7608 )
- Hex:6 HexNAc:5 dHex:1 NeuAc:3 (avg mass : 3026.7614 )
- Hex:6 HexNAc:5 dHex:2 (avg mass : 2299.1307 )
- Hex:6 HexNAc:5 dHex:2 NeuAc:1 (avg mass : 2590.3886 )
- Hex:6 HexNAc:5 dHex:3 (avg mass : 2445.2737 )
- Hex:6 HexNAc:5 dHex:3 NeuGc:1 (avg mass : 2752.531 )
- Hex:6 HexNAc:5 dHex:3 NeuAc:1 (avg mass : 2736.5316 )
- Hex:6 HexNAc:6 NeuAc:1 (avg mass : 2501.2976 )
- Hex:6 HexNAc:6 NeuAc:1 NeuGc:1 (avg mass : 2808.5549 )
- Hex:6 HexNAc:6 NeuAc:2 (avg mass : 2792.5555 )
- Hex:6 HexNAc:6 dHex:1 (avg mass : 2356.1827 )
- Hex:6 HexNAc:6 dHex:1 NeuGc:3 (avg mass : 3277.9546 )
- Hex:6 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2647.4406 )
- Hex:6 HexNAc:6 dHex:1 NeuAc:1 Su:2 (avg mass : 2807.569 )
- Hex:6 HexNAc:6 dHex:1 NeuAc:1 NeuGc:1 (avg mass : 2954.6979 )
- Hex:6 HexNAc:6 dHex:1 NeuAc:2 (avg mass : 2938.6985 )
- Hex:6 HexNAc:6 dHex:1 NeuAc:2 Su:1 (avg mass : 3018.7627 )
- Hex:6 HexNAc:6 dHex:1 NeuAc:2 NeuGc:1 (avg mass : 3245.9558 )
- Hex:6 HexNAc:6 dHex:1 NeuAc:3 (avg mass : 3229.9564 )
- Hex:6 HexNAc:6 dHex:2 (avg mass : 2502.3257 )
- Hex:6 HexNAc:7 (avg mass : 2413.2347 )
- Hex:6 HexNAc:7 dHex:1 (avg mass : 2559.3777 )
- Hex:6 HexNAc:7 dHex:1 NeuAc:2 Su:1 (avg mass : 3221.9577 )
- Hex:6 HexNAc:8 (avg mass : 2616.4297 )
- Hex:6 HexNAc:9 (avg mass : 2819.6247 )
- Hex:6 HexNAc:9 dHex:1 (avg mass : 2965.7677 )
- Hex:7 HexNAc:2 (avg mass : 1559.4021 )
- Hex:7 HexNAc:3 NeuAc:1 Ph:1 (avg mass : 2133.8349 )
- Hex:7 HexNAc:4 (avg mass : 1965.7921 )
- Hex:7 HexNAc:4 NeuAc:1 (avg mass : 2257.05 )
- Hex:7 HexNAc:4 NeuAc:1 Ph:1 (avg mass : 2337.0299 )
- Hex:7 HexNAc:4 dHex:1 (avg mass : 2111.9351 )
- Hex:7 HexNAc:4 dHex:2 (avg mass : 2258.0781 )
- Hex:7 HexNAc:5 (avg mass : 2168.9871 )
- Hex:7 HexNAc:5 NeuAc:2 (avg mass : 2751.5029 )
- Hex:7 HexNAc:5 NeuAc:3 (avg mass : 3042.7608 )
- Hex:7 HexNAc:5 NeuAc:4 (avg mass : 3334.0187 )
- Hex:7 HexNAc:5 dHex:1 (avg mass : 2315.1301 )
- Hex:7 HexNAc:5 dHex:1 NeuGc:2 (avg mass : 2929.6447 )
- Hex:7 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2606.388 )
- Hex:7 HexNAc:5 dHex:1 NeuAc:1 NeuGc:1 (avg mass : 2913.6453 )
- Hex:7 HexNAc:5 dHex:1 NeuAc:2 (avg mass : 2897.6459 )
- Hex:7 HexNAc:6 (avg mass : 2372.1821 )
- Hex:7 HexNAc:6 NeuGc:1 (avg mass : 2679.4394 )
- Hex:7 HexNAc:6 NeuGc:2 (avg mass : 2986.6967 )
- Hex:7 HexNAc:6 NeuAc:1 (avg mass : 2663.44 )
- Hex:7 HexNAc:6 NeuAc:1 NeuGc:1 (avg mass : 2970.6973 )
- Hex:7 HexNAc:6 NeuAc:2 (avg mass : 2954.6979 )
- Hex:7 HexNAc:6 NeuAc:2 Su:2 (avg mass : 3114.8263 )
- Hex:7 HexNAc:6 NeuAc:2 NeuGc:1 (avg mass : 3261.9552 )
- Hex:7 HexNAc:6 NeuAc:2 NeuGc:2 (avg mass : 3569.2125 )
- Hex:7 HexNAc:6 NeuAc:3 (avg mass : 3245.9558 )
- Hex:7 HexNAc:6 NeuAc:3 Su:1 (avg mass : 3326.02 )
- Hex:7 HexNAc:6 NeuAc:3 NeuGc:1 (avg mass : 3553.2131 )
- Hex:7 HexNAc:6 NeuAc:4 (avg mass : 3537.2137 )
- Hex:7 HexNAc:6 dHex:1 (avg mass : 2518.3251 )
- Hex:7 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2809.583 )
- Hex:7 HexNAc:6 dHex:1 NeuAc:2 (avg mass : 3100.8409 )
- Hex:7 HexNAc:6 dHex:1 NeuAc:2 Su:2 (avg mass : 3260.9693 )
- Hex:7 HexNAc:6 dHex:1 NeuAc:3 (avg mass : 3392.0988 )
- Hex:7 HexNAc:6 dHex:1 NeuAc:3 Su:1 (avg mass : 3472.163 )
- Hex:7 HexNAc:6 dHex:1 NeuAc:3 NeuGc:1 (avg mass : 3699.3561 )
- Hex:7 HexNAc:6 dHex:1 NeuAc:4 (avg mass : 3683.3567 )
- Hex:7 HexNAc:6 dHex:4 NeuGc:1 (avg mass : 3264.0114 )
- Hex:7 HexNAc:6 dHex:4 NeuAc:1 (avg mass : 3248.012 )
- Hex:7 HexNAc:7 NeuAc:1 Su:3 (avg mass : 3106.8276 )
- Hex:7 HexNAc:7 dHex:1 (avg mass : 2721.5201 )
- Hex:7 HexNAc:7 dHex:1 NeuAc:1 Su:3 (avg mass : 3252.9706 )
- Hex:7 HexNAc:7 dHex:1 NeuAc:2 Su:2 (avg mass : 3464.1643 )
- Hex:7 HexNAc:7 dHex:1 NeuAc:2 NeuGc:1 (avg mass : 3611.2932 )
- Hex:7 HexNAc:7 dHex:1 NeuAc:3 (avg mass : 3595.2938 )
- Hex:7 HexNAc:7 dHex:1 NeuAc:3 Su:1 (avg mass : 3675.358 )
- Hex:7 HexNAc:7 dHex:1 NeuAc:4 (avg mass : 3886.5517 )
- Hex:7 HexNAc:8 (avg mass : 2778.5721 )
- Hex:7 HexNAc:8 NeuAc:2 Su:2 (avg mass : 3521.2163 )
- Hex:7 HexNAc:8 dHex:1 NeuAc:2 Su:2 (avg mass : 3667.3593 )
- Hex:7 HexNAc:9 dHex:1 NeuAc:4 (avg mass : 4292.9417 )
- Hex:7 HexNAc:10 (avg mass : 3184.9621 )
- Hex:7 HexNAc:10 dHex:1 NeuAc:4 (avg mass : 4496.1367 )
- Hex:8 HexNAc:2 (avg mass : 1721.5445 )
- Hex:8 HexNAc:5 (avg mass : 2331.1295 )
- Hex:8 HexNAc:5 dHex:1 (avg mass : 2477.2725 )
- Hex:8 HexNAc:5 dHex:4 (avg mass : 2915.7015 )
- Hex:8 HexNAc:6 NeuAc:1 (avg mass : 2825.5824 )
- Hex:8 HexNAc:6 NeuAc:2 (avg mass : 3116.8403 )
- Hex:8 HexNAc:6 NeuAc:3 (avg mass : 3408.0982 )
- Hex:8 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2971.7254 )
- Hex:8 HexNAc:7 NeuGc:1 (avg mass : 3044.7768 )
- Hex:8 HexNAc:7 NeuAc:1 (avg mass : 3028.7774 )
- Hex:8 HexNAc:7 dHex:1 (avg mass : 2883.6625 )
- Hex:8 HexNAc:7 dHex:1 NeuGc:2 (avg mass : 3498.1771 )
- Hex:8 HexNAc:7 dHex:1 NeuAc:1 (avg mass : 3174.9204 )
- Hex:8 HexNAc:7 dHex:1 NeuAc:1 NeuGc:1 (avg mass : 3482.1777 )
- Hex:8 HexNAc:7 dHex:1 NeuAc:2 (avg mass : 3466.1783 )
- Hex:8 HexNAc:7 dHex:1 NeuAc:2 NeuGc:1 (avg mass : 3773.4356 )
- Hex:8 HexNAc:7 dHex:1 NeuAc:3 (avg mass : 3757.4362 )
- Hex:8 HexNAc:7 dHex:1 NeuAc:4 (avg mass : 4048.6941 )
- Hex:8 HexNAc:8 (avg mass : 2940.7145 )
- Hex:8 HexNAc:8 dHex:1 (avg mass : 3086.8575 )
- Hex:9 HexNAc:2 (avg mass : 1883.6869 )
- Hex:9 HexNAc:5 dHex:1 (avg mass : 2639.4149 )
- Hex:9 HexNAc:6 (avg mass : 2696.4669 )
- Hex:9 HexNAc:6 dHex:1 NeuAc:1 NeuGc:1 (avg mass : 3441.1251 )
- Hex:9 HexNAc:6 dHex:1 NeuAc:2 (avg mass : 3425.1257 )
- Hex:9 HexNAc:8 dHex:1 (avg mass : 3248.9999 )
- Hex:9 HexNAc:9 dHex:1 (avg mass : 3452.1949 )
- Hex:10 HexNAc:2 (avg mass : 2045.8293 )
- Hex:10 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 3296.0102 )
- Hex:10 HexNAc:9 dHex:1 (avg mass : 3614.3373 )
- Hex:10 HexNAc:9 dHex:1 NeuAc:4 (avg mass : 4779.3689 )
- Hex:10 HexNAc:10 dHex:1 (avg mass : 3817.5323 )
- Hex:11 HexNAc:2 (avg mass : 2207.9717 )
- Hex:11 HexNAc:6 dHex:1 (avg mass : 3166.8947 )
- Hex:11 HexNAc:11 NeuGc:1 (avg mass : 4343.984 )
- Hex:11 HexNAc:11 NeuAc:1 (avg mass : 4327.9846 )
Composition
- Anemia, Aplastic (DOID:12449)
- Aspartylglycosaminuria (DOID:0050461)
- Carcinoid Tumor, with multiple liver metastasis
- Choriocarcinoma (DOID:3594)
- Choriocarcinoma, with Hyperthyroidism
- Diabetes Mellitus (DOID:9351)
- Dyscrasia, Plasma Cell (DOID:6536)
- Fucosidosis (DOID:14500)
- Gangliosidosis GM1 (DOID:3322)
- Heavy Chain Disease (DOID:0060125)
- Hydatidiform Mole (DOID:3590)
- Hydatidiform Mole, Invasive (DOID:3590)
- Infantile Sialidosis, Type II (Dysmorphic) (DOID:3343)
- Lysosomal storage disease (DOID:3211)
- Mannosidosis, alpha (DOID:3413)
- Mannosidosis, beta (DOID:3633)
- Prostate cancer (DOID:10283)
- Prostate Disease (DOID:47)
- Sialidosis (Mucolipidosis I) (DOID:3343)
- Sialidosis, severe infantile with abdominal ascites (DOID:3343)
- Sialuria (DOID:3659)
Disease
- Profiling the proteoforms of urinary prostate-specific antigen by capillary electrophoresis – mass spectrometry (2021 - Alan B. Moran, Elena Domínguez-Vega, Jan Nouta, Tamas Pongracz, Theo M. de Reijke, Manfred Wuhrer, Guinevere S.M. Lageveen-Kammeijer) / Status : Reviewed
- Novel O-linked sialoglycan structures in human urinary glycoproteins (2020 - Adam Pap, Ervin Tasnadi, Katalin F. Medzihradszky, Zsuzsanna Darula ) / Status : Reviewed
- Extended Sialylated O-Glycan Repertoire of Human Urinary Glycoproteins Discovered and Characterized Using Electron-Transfer/Higher-Energy Collision Dissociation (2019 - Zsuzsanna Darula, Ádám Pap, Katalin F. Medzihradszky) / Status : Reviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD (2012 - Halim A, Nilsson J, Rüetschi U, Hesse C, Larson G) / Status : Reviewed
- Glycosylated major urinary protein of the house mouse: characterization of its N-linked oligosaccharides. (2000 - Mechref Y, Zidek L, Ma W, Novotny M) / Status : Reviewed
- Structure of the asparagine-linked sugar chains of porcine kidney and human urine cerebroside sulfate activator protein. (2000 - Faull K, Johnson J, Kim M, To T, Whitelegge J, Stevens R, Fluharty C, Fluharty A) / Status : Reviewed
- Novel proteoglycan linkage tetrasaccharides of human urinary soluble thrombomodulin, SO4-3GlcAbeta1-3Galbeta1-3(+/-Siaalpha2-6)Galbeta1-4Xyl. (1999 - Wakabayashi H, Natsuka S, Mega T, Otsuki N, Isaji M, Naotsuka M, Koyama S, Kanamori T, Sakai K, Hase S) / Status : Reviewed
- Glycosylation sites and site-specific glycosylation in human Tamm-Horsfall glycoprotein. (1999 - van Rooijen J, Voskamp A, Kamerling J, Vliegenthart J) / Status : Reviewed
- Purification and characterization of the MUC1 mucin-type glycoprotein, epitectin, from human urine: structures of the major oligosaccharide alditols. (1998 - Bhavanandan V, Zhu Q, Yamakami K, Dilulio N, Nair S, Capon C, Lemoine J, Fournet B) / Status : Reviewed
- Sulfated di-, tri- and tetraantennary N-glycans in human Tamm-Horsfall glycoprotein. (1998 - van Rooijen J, Kamerling J, Vliegenthart J) / Status : Reviewed
- Phosphorylation and O-glycosylation sites of human chromogranin A (CGA79-439) from urine of patients with carcinoid tumors. (1998 - Gadroy P, Stridsberg M, Capon C, Michalski J, Strub J, Van Dorsselaer A, Aunis D, Metz-Boutigue M) / Status : Reviewed
- Carbohydrate and peptide structure of the alpha- and beta-subunits of human chorionic gonadotropin from normal and aberrant pregnancy and choriocarcinoma. (1997 - Elliott M, Kardana A, Lustbader J, Cole L) / Status : Reviewed
- Spectroscopic and protein chemical analyses demonstrate the presence of C-mannosylated tryptophan in intact human RNase 2 and its isoforms. (1996 - Loffler A, Doucey M, Jansson A, Muller D, de Beer T, Hess D, Meldal M, Richter W, Vliegenthart J, Hofsteenge J) / Status : Reviewed
- Characterization of four monosialo and a novel disialo Asn N-glycosides from the urine of a patient with aspartylglycosaminuria. (1995 - Irie F, Murakoshi H, Suzuki T, Suzuki Y, Kon K, Ando S, Yoshida K, Hirabayashi Y) / Status : Reviewed
- Rapid and simple approach for the NMR resonance assignment of the carbohydrate chains of an intact glycoprotein. Application of gradient-enhanced natural abundance 1H-13C HSQC and HSQC-TOCSY to the alpha-subunit of human chorionic gonadotropin. (1994 - de Beer T, van Zuylen C, Hard K, Boelens R, Kaptein R, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structural study on the glycosyl-phosphatidylinositol anchor and the asparagine-linked sugar chain of a soluble form of CD59 in human urine. (1994 - Nakano Y, Noda K, Endo T, Kobata A, Tomita M) / Status : Reviewed
- Structural elucidation of a variety of GalNAc-containing N-linked oligosaccharides from human urinary kallidinogenase. (1993 - Tomiya N, Awaya J, Kurono M, Hanzawa H, Shimada I, Arata Y, Yoshida T, Takahashi N) / Status : Reviewed
- Primary structure of N-linked carbohydrate chains of a human chimeric plasminogen activator K2tu-PA expressed in Chinese hamster ovary cells. (1993 - Bergwerff A, van Oostrum J, Asselbergs F, Brgi R, Hokke C, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structures of mucin-type sugar chains on human erythropoietins purified from urine and the culture medium of recombinant Chinese hamster ovary cells. (1993 - Inoue N, Takeuchi M, Asano K, Shimizu R, Takasaki S, Kobata A) / Status : Reviewed
- Human urokinase contains GalNAc beta (1-4)[Fuc alpha (1-3)]GlcNAc beta (1-2) as a novel terminal element in N-linked carbohydrate chains. (1992 - Bergwerff A, Thomas-Oates J, van Oostrum J, Kamerling J, Vliegenthart J) / Status : Reviewed
- Severe infantile sialidosis--the characteristics of oligosaccharides isolated from the urine and the abdominal ascites. (1992 - Nakamura Y, Takahashi Y, Yamaguchi S, Omiya S, Orii T, Yara A, Gushiken M) / Status : Reviewed
- The Asn-linked carbohydrate chains of human Tamm-Horsfall glycoprotein of one male. Novel sulfated and novel N-acetylgalactosamine-containing N-linked carbohydrate chains. (1992 - Hard K, Van Zadelhoff G, Moonen P, Kamerling J, Vliegenthart F) / Status : Reviewed
- Characterization and 400-MHz 1H-NMR analysis of urinary fucosyl glycoasparagines in fucosidosis. (1991 - Michalski J, Wieruszeski J, Alonso C, Cache P, Montreuil J, Strecker G) / Status : Reviewed
- A comparative study of sialyloligosaccharides isolated from sialidosis and galactosialidosis urine. (1991 - van Pelt J, Kamerling J, Bakker H, Vliegenthart J) / Status : Reviewed
- Characterization of a posttranslational fucosylation in the growth factor domain of urinary plasminogen activator. (1991 - Buko A, Kentzer E, Petros A, Menon G, Zuiderweg E, Sarin V) / Status : Reviewed
- Site-specific N-glycosylation of human chorionic gonadotrophin--structural analysis of glycopeptides by one- and two-dimensional 1H NMR spectroscopy. (1991 - Weisshaar G, Hiyama J, Renwick A) / Status : Reviewed
- Characterization of a novel type of chain-terminator Gal beta 1-6Gal beta 1-4)GlcNAc in an oligosaccharide related to N-glycosylated protein glycans isolated from GM1 the urine of patients with gangliosidosis. (1991 - Michalski J, Lemoine J, Wieruszeski J, Fournet B, Montreuil J, Strecker G) / Status : Reviewed
- Different oligosaccharides accumulate in the brain and urine of a cat with alpha-mannosidosis: structure determination of five brain-derived and seventeen urinary oligosaccharides. (1991 - Hard K, Mekking A, Kamerling J, Dacremont G, Vliegenthart J) / Status : Reviewed
- Pregnancy-associated changes in oligomannose oligosaccharides of human and bovine uromodulin (Tamm-Horsfall glycoprotein). (1990 - Smagula R, Van Halbeek H, Decker J, Muchmore A, Moody C, Sherblom A) / Status : Reviewed
- Altered glycosylation of human chorionic gonadotropin decreases its hormonal activity as determined by cyclic-adenosine 3',5'-monophosphate production in MA-10 cells. (1990 - Amano J, Nishimura R, Sato S, Kobata A) / Status : Reviewed
- Sialyl-alpha 2-6-mannosyl-beta 1-4-N-acetylglucosamine, a novel compound occurring in urine of patients with beta-mannosidosis. (1990 - van Pelt J, Dorland L, Duran M, Hokke C, Kamerling J, Vliegenthart J) / Status : Reviewed
- Location and characterization of the three carbohydrate prosthetic groups of human protein HC. (1990 - Escribano J, Lopex-Otin C, Hjerpe A, Grubb A, Mendez E) / Status : Reviewed
- Isolation and structural characterization of sialic-acid-containing glycopeptides of the O-glycosidic type from the urine of two patients with an hereditary deficiency in alpha-N-acetylgalactosaminidase activity. (1989 - Linden H, Klein R, Egge H, Peter-Katalinic J, Dabrowski J, Schindler D) / Status : Reviewed
- Comparative study of the asparagine-linked sugar chains of human erythropoietins purified from urine and the culture medium of recombinant Chinese hamster ovary cells. (1988 - Takeuchi M, Takasaki S, Miyazaki H, Kato T, Hoshi S, Kochibe N, Kobata A) / Status : Reviewed
- Comparative study of the mucin-type sugar chains of human chorionic gonadotropin present in the urine of patients with trophoblastic diseases and healthy pregnant women. (1988 - Amano J, Nishimura R, Mochizuki M, Kobata A) / Status : Reviewed
- Structural analysis of O-glycosidic type of sialyloligosaccharide-alditols derived from urinary glycopeptides of a sialidosis patient. (1988 - van Pelt J, Van Bilsen D, Kamerling J, Vliegenthart J) / Status : Reviewed
- Comparative structural study of N-linked oligosaccharides of urinary and recombinant erythropoietins. (1988 - Tsuda E, Goto M, Murakami A, Akai K, Ueda M, Kawanishi G, Takahashi N, Sasaki R, Chiba H, Ishihara H) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
- Isolation and characterization of novel phosphate-containing sialyloligosaccharides from normal human urine. (1984 - Parkkinen J, Finne J) / Status : Reviewed
- The structure of sialyl-glycopeptides of the O-glycosidic type, isolated from sialidosis (mucolipidosis I) urine. (1984 - Lecat D, Lemonnier M, Derappe C, Lhermitte M, van Halbeek H, Dorland L, Vliegenthart J) / Status : Reviewed
- Isolation and structural characterization of five major sialyloligosaccharides and a sialylglycopeptide from normal human urine. (1983 - Parkkinen J, Finne J) / Status : Reviewed
- Structures of the asparagine-linked sugar chains of human chorionic gonadotropin produced in choriocarcinoma. Appearance of triantennary sugar chains and unique biantennary sugar chains. (1983 - Mizuochi T, Nishimura R, Derappe C, Taniguchi T, Hamamoto T, Mochizuki M, Kobata A) / Status : Reviewed
- Structures of sialylated O-glycosidically and N-glycosidically linked oligosaccharides in a monoclonal immunoglobulin light chain. (1981 - Chandrasekaran EV, Mendicino A, Garver FA, Mendicino J) / Status : Reviewed
- Localization of the carbohydrate units in a human immunoglobulin light chain, protein Sm lambda. (1981 - Garver F, Chang L, Kiefer C, Mendicino J, Chandrasekaran E, Isobe T, Osserman E) / Status : Reviewed
- Urinary oligosaccharides of fucosidosis. Evidence of the occurrence of X-antigenic determinant in serum-type sugar chains of glycoproteins. (1978 - Nishigaki M, Yamashita K, Matsuda I, Arashima S, Kobata A) / Status : Reviewed
- Isolation and identification of 2-deoxy-2,3-dehydro-N-acetylneuraminic acid from the urine of a patient with sialuria. (1975 - Kamerling JP, Vliegenthart JF) / Status : Reviewed
- A new type of carbohydrate-protein linkage in a glycopeptide from normal human urine. (1975 - Hallgren P, Lundblad A, Svensson S) / Status : Reviewed
Reference
-
3-O-beta-D-glucopyranosyl-alpha-L-fucopyranosyl-L-threonine / Homo sapiens
- Undefined site
- A disintegrin and metalloproteinase with thrombospondin motifs 5 / Homo sapiens
- Afamin / Homo sapiens
- Aggrecan core protein / Homo sapiens
- Alpha-1-acid glycoprotein 1 / Homo sapiens
- Alpha-1-acid glycoprotein 2 / Homo sapiens
- Alpha-1-antichymotrypsin / Homo sapiens
- Alpha-1-antitrypsin / Homo sapiens
- Alpha-2-HS-glycoprotein / Homo sapiens
- Angiopoietin-related protein 3 / Homo sapiens
- Antithrombin-III / Homo sapiens
- Apolipoprotein C-III / Homo sapiens
- Apolipoprotein D / Homo sapiens
- Apolipoprotein F / Homo sapiens
- Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
- Beta-2-glycoprotein 1 / Homo sapiens
- Beta-defensin 1 / Homo sapiens
- C-C motif chemokine 24 / Homo sapiens
- Carboxypeptidase b2 / Homo sapiens
- CD27 antigen / Homo sapiens
- CD44 antigen / Homo sapiens
- CD59 glycoprotein / Homo sapiens
- CD99 antigen / Homo sapiens
- Cell adhesion molecule 1 / Homo sapiens
- Ceruloplasmin / Homo sapiens
-
Choriogonadotropin - alpha and beta chains / Homo sapiens
- Undefined site
- Choriogonadotropin beta chain / Homo sapiens
- Chromogranin a / Homo sapiens
- Clusterin / Homo sapiens
- Collagen alpha-1(xv) chain / Homo sapiens
- Complement C1r subcomponent-like protein / Homo sapiens
- Complement C4-B / Homo sapiens
- Complement component c7 / Homo sapiens
- Complement factor i / Homo sapiens
- Corticosteroid-binding globulin / Homo sapiens
- Cyclic amp-responsive element-binding protein 3-like protein 3 / Homo sapiens
- Deoxyribonuclease-1 / Homo sapiens
- Disintegrin and metalloproteinase domain-containing protein 8 / Homo sapiens
- Ecto-ADP-ribosyltransferase 3 / Homo sapiens
- Ecto-adp-ribosyltransferase 3 / Homo sapiens
-
Erythropoietin / Homo sapiens
- Undefined site
- Extracellular matrix protein 1 / Homo sapiens
- Extracellular sulfatase Sulf-2 / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibrinogen gamma chain / Homo sapiens
- Fibroblast growth factor receptor 2 / Homo sapiens
- Fibronectin / Homo sapiens
- Fibronectin type III domain-containing protein 4 / Homo sapiens
- Fractalkine / Homo sapiens
- Frizzled-4 / Homo sapiens
-
Glandular kallikrein 1 / Homo sapiens
- Undefined site
- Glycophorin a, b and c / Homo sapiens
- Glycophorin-A / Homo sapiens
- Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
- Haptoglobin / Homo sapiens
- Hemopexin / Homo sapiens
- Hepatitis a virus cellular receptor 2 / Homo sapiens
- HLA class II histocompatibility antigen gamma chain / Homo sapiens
- Icos ligand / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Immunoglobulin lambda-1 light chain / Homo sapiens
- Insulin-like growth factor II / Homo sapiens
- Insulin-like growth factor-binding protein 6 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h2 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Interleukin-18-binding protein / Homo sapiens
- Kallistatin / Homo sapiens
- Kininogen-1 / Homo sapiens
- Lactotransferrin / Homo sapiens
- Leucine-rich alpha-2-glycoprotein / Homo sapiens
- Leukocyte-associated immunoglobulin-like receptor 1 / Homo sapiens
- Lymphatic vessel endothelial hyaluronic acid receptor 1 / Homo sapiens
- Lysosomal acid phosphatase / Homo sapiens
- Macrophage colony-stimulating factor 1 / Homo sapiens
- Membrane protein FAM174A / Homo sapiens
- Metalloproteinase inhibitor 1 / Homo sapiens
- Microfibrillar-associated protein 5 / Homo sapiens
- Midasin / Homo sapiens
-
Mucin-1 / Homo sapiens
- Undefined site
- Multimerin-1 / Homo sapiens
- Myeloperoxidase / Homo sapiens
- N-acetylmuramoyl-l-alanine amidase / Homo sapiens
- Neuroblastoma suppressor of tumorigenicity 1 / Homo sapiens
-
Non-secretory ribonuclease / Homo sapiens
- Undefined site
- Trp-34
- Olfactomedin-4 / Homo sapiens
- Osteopontin / Homo sapiens
- Ovochymase-1 / Homo sapiens
- Phosphoinositide-3-kinase-interacting protein 1 / Homo sapiens
- Plasma protease c1 inhibitor / Homo sapiens
- Plasma serine protease inhibitor / Homo sapiens
- Poliovirus receptor / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Progranulin / Homo sapiens
- Proheparin-binding EGF-like growth factor / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
- Prosaas / Homo sapiens
- Prosaposin / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostatic acid phosphatase / Homo sapiens
- Protein AMBP / Homo sapiens
- Protein delta homolog 1 / Homo sapiens
- Protein heg homolog 1 / Homo sapiens
- Protein YIPF3 / Homo sapiens
- Protein-lysine 6-oxidase / Homo sapiens
- Prothrombin / Homo sapiens
- Receptor tyrosine-protein kinase erbB-2 / Homo sapiens
- Receptor-type tyrosine-protein phosphatase-like n / Homo sapiens
- Roundabout homolog 4 / Homo sapiens
- Semenogelin-2 / Homo sapiens
- Serotransferrin / Homo sapiens
- Serum albumin / Homo sapiens
- Small integral membrane protein 3 / Homo sapiens
- Sparc-like protein 1 / Homo sapiens
- Syndecan-2 / Homo sapiens
-
Thrombomodulin / Homo sapiens
- Undefined site
- Thyroxine-binding globulin / Homo sapiens
- Transmembrane protease serine 2 / Homo sapiens
- Transmembrane protein C16orf54 / Homo sapiens
- Tumor necrosis factor receptor superfamily member 6 / Homo sapiens
- Tyrosine-protein kinase receptor UFO / Homo sapiens
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
Urine glycopeptide / Homo sapiens
- Undefined site
- Urokinase-type plasminogen activator / Homo sapiens
- Uromodulin / Homo sapiens
- Vasorin / Homo sapiens
- Versican core protein / Homo sapiens
- Vitamin k-dependent protein c / Homo sapiens
- WAP four-disulfide core domain protein 2 / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
-
Major urinary protein / Mus musculus
- Undefined site
Reported glycosite
- PLTPEPPSGR (10aa)
- MDAVSQVPMEVVLPK (15aa)
- EEFDEIPTVVGIF (13aa)
- IDQDNSSFDSLSPEPK (16aa)
- GNFLTGLGHR (10aa)
- DIENFNSTQK (10aa)
- MALSWVLTVLSLLPLLEAQIPLCANLVPVPITNATLDQITGK (42aa)
- VTACHSSQPNATLYK (15aa)
- ASSNPNATSSSSQDPESLQDRGEGK (25aa)
- AGQPPTAAAAAQPR (14aa)
- ASSNPNATSSSSQDPESLQDR (21aa)
- GLAAGTSNPDPPTVSTDQLLPLGGGRDR (28aa)
- GLAAGTSNPDPPTVSTDQLLPLGGGRDRK (29aa)
- EDQTSPAPGLR (11aa)
- NITQIVGHSGCEAK (14aa)
- MSNATLVSYIVQILSR (16aa)
- TAVNCSSDFDACLITKAGLQVYNK (24aa)
- TAVNCSSDFDACLITKAGLQVYNKCWK (27aa)
- AYDGLSLPEDIETVTASQMR (20aa)
- SDALPDNENKKPTAIPK (17aa)
- SLPEDIETVTASQMR (15aa)
- TAVNCSSDFDACLITK (16aa)
- TGVCPELQADQNCTQECVSDSECADNLK (28aa)
- YKNNSDISSTR (11aa)
- GLAAGTSNPDPPTVSTDQLLPLGGGR (26aa)
- RGLAAGTSNPDPPTVSTDQLLPLGGGR (27aa)
- VATTVISK (8aa)
- WTHSYL (6aa)
- WFSAGLASNSSWLREK (16aa)
- WFSAGLASNSSWLR (14aa)
- FVGTPEVNQTTLYQR (15aa)
- ANQQLNFTEAK (11aa)
- NEEYNK (6aa)
- DTYAATPR (8aa)
- WFYIASAFRNEEYNK (15aa)
- AFNSTLPTMAQMEK (14aa)
- CLNWLDAQSGLASAPVSGAGNHSYCRNPDEDPR (33aa)
- TLPPLPPGPTPAQQPGR (17aa)
- PRTLPPLPPGPTPAQQPGR (19aa)
- CSDGWSFDATTLDDNGTMLFFK (22aa)
- CIQANYSLMENGK (13aa)
- CLNWLDAQSGLASAPVSGAGNHSYCR (26aa)
- DLQSLEDILHQVENKTSEVK (20aa)
- STYNDTEDVSQASPSESEAR (20aa)
- NK (2aa)
- MLFVEPILEVSSLPTTNSTTNSATK (25aa)
- TVVTYHIPQNSSLENVDSR (19aa)
- IIVPLNNRENISDPTSPLR (19aa)
- ENISDPTSPLR (11aa)
- SVQEIQATFFYFTPNK (16aa)
- KQVHFFVNASDVDNVK (16aa)
- QVHFFVNASDVDNVK (15aa)
- SVVAPATDGGLNLTSTFLRK (20aa)
- DLQSLEDILHQVENK (15aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- SVVAPATDGGLNLTSTFLRKNQCETR (26aa)
- RDPGAAVPGAANASAQQPR (19aa)
- DPGAAVPGAANASAQQPR (18aa)
- AFITNFSMIIDGMTYPGIIK (20aa)
- DGVHLGPNNR (10aa)
- KEDALNETR (9aa)
- EDALNETR (8aa)
- DLLGSGYTETYTAANGSEVTEQPR (24aa)
- APEPGAATQR (10aa)
- QDQCIYNTTYLNVQR (15aa)
- FLNESYK (7aa)
- NCTITANAECACR (13aa)
- AQLLQGLGFNLTER (14aa)
- ADGTVNQIEGEATPVNLTEPAKLEVK (26aa)
- ADGTVNQIEGEATPVNLTEPAK (22aa)
- DVSTPPTVLPDNFPR (15aa)
- SERDVSTPPTVLPDNFPR (18aa)
- FQLLNFSSSELK (12aa)
- LFNVTPQDEQK (11aa)
- FLNNGTCTAEGK (12aa)
- KDLCNFNEQLENGGTSLSEK (20aa)
- TFYWDFYTNR (10aa)
- DLCNFNEQLENGGTSLSEK (19aa)
- DIVEYYNDSNGSHVLQGR (18aa)
- DLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP (37aa)
- YPGNQTTC (8aa)
- WNITMESYVVHTNYDEYAIFLTK (23aa)
- LHEITNETFR (10aa)
- DKLAACLEGNCAEGLGTNYRGHVNITR (27aa)
- GHVNITR (7aa)
- GHVNITRSGIECQLWR (16aa)
- ESKPQAGTARPQDVNR (16aa)
- FGCEIENNR (9aa)
- LGACNDTLQQLMEVFK (16aa)
- FNPGAESVVLSNSTLK (16aa)
- EHEGAIYPDNTTDFQR (16aa)
- NVSVEALASALQLLAR (16aa)
- YPHKPEINSTTHPGADLQENFCR (23aa)
- SRYPHKPEINSTTHPGADLQENFCR (25aa)
- EFGFAWPESLNCSK (14aa)
- AENQTAPGEVPALSNLRPPSR (21aa)
- DFTAAFPR (8aa)
- ALVLEQLTPALHSTNFSCVLVDPEQVVQR (29aa)
- LPSNSSSPGDITVEGLDGER (20aa)
- YLNEYNGSYVPPGWKEWVGLLK (22aa)
- GDGWHCECSPGSCGPGLDCVPEGDALVCADPCQAHR (36aa)
- KVCQDCPLLAPLNDTR (16aa)
- VCQDCPLLAPLNDTR (15aa)
- FLNDTMAVYEAK (12aa)
- VYKPSAGNNSLYR (13aa)
- GFLALYQTVAVNYSQPISEASR (22aa)
- TKPREEQFNSTFR (13aa)
- AALAAFNAQNNGSNFQLEEISR (22aa)
- EEQFNSTFR (9aa)
- QTPEYQNESSR (11aa)
- EEQYNSTYR (9aa)
- TKPREEQYNSTYR (13aa)
- AQDGGPVGTELFR (13aa)
- RPDIQYPDATDEDITSHMESEELNGAYK (28aa)
- KLPPGLLANFTLLR (14aa)
- LPPGLLANFTLLR (13aa)
- SWPAVGNCSSALR (13aa)
- SLTFNETYQDISELVYGAK (19aa)
- SLHVPGLNK (9aa)
- ITYSIVQTNCSK (12aa)
- TPLTANITK (9aa)
- LNTSAGNVDIYK (12aa)
- TNSTFVQALVEHVKEECDR (19aa)
- MAETCVPVLRCNTAAPMWLNGTHPSSDEGIVSR (33aa)
- FSDGLESNSSTQFEVK (16aa)
- CNTAAPMWLNGTHPSSDEGIVSR (23aa)
- DTFVNASR (8aa)
- VVLHPNYSQVDIGLIK (16aa)
- IQLENVTLLNPDPAEGPKPR (20aa)
- YFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCR (36aa)
- DQNTPVVHPPPTPGSCGHGGVVNISK (26aa)
- VWGQGQSPRPENSLER (16aa)
- VWGQGQSPRPE (11aa)
- VLSNNSDANLELINTWVAK (19aa)
- YFYNGTSMACETFQYGGCMGNGNNFVTEK (29aa)
- VVGVPYQGNATALFILPSEGK (21aa)
- VHTECCHGDLLECADDR (17aa)
- YTGNASALFILPDQDK (16aa)
- EEMGPVPAHTDAF (13aa)
- YLGNATAIFFLPDEGK (16aa)
- ACAHWSGHCCLWDASVQVKACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGR (66aa)
- LNAENNATFYFK (12aa)
- ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCK (42aa)
- IDGSQNFNETWENYK (15aa)
- ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGR (47aa)
- ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGRWHCQCK (53aa)
- ILEPTQIPGMK (11aa)
- WHCQCKQDFNITDISLLEHR (20aa)
- QDFNITDISLLEHR (14aa)
- SCPACPGSNITIR (13aa)
- MFSQNDTR (8aa)
- SHCIAEVENDEMPADLPSLAADFVESKDVCK (31aa)
- NETQHEPYPLMLPGCSPSCPLER (23aa)
- LPTTVLNATAK (11aa)
- AVAVTLQSH (9aa)
- NHGVDDDGDDDGDDGGTDGPR (21aa)
- SLTVSLGPVSKTEGFPK (17aa)
- AGLQAFFQVQECNK (14aa)
- AGLQAFFQVQECNKSSSK (18aa)
- LANLTQGEDQYYLR (14aa)
- VGPVRPTGQDWNHTPQK (17aa)
- ALLPFDNLHDDPCLLTNR (18aa)
- ALLPFDNLHDDPCLLTNRSAR (21aa)
- ENLTAPGSDSAVFFEQGTTR (20aa)
- LNDTTLQVLNTWYTK (15aa)
- LSLLEEPGNGTFTVILNQLTSR (22aa)
- CGLVPVLAENYNK (13aa)
- CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa)
- CGLVPVLAENYKSQQSSDPDPNCVDR (26aa)
- ALPQPQNVTSLLGCTH (16aa)
- ALPQPQNVTSLLGCT (15aa)
- VPGNVTAVLGETLK (14aa)
- SYNDSVDPR (9aa)
- TAGWNIPMGLLFNQTGSCK (19aa)
- WNNTGCQALPSQDEGPSK (18aa)
- FALLMTNCYATPSSNATDPLKYFIIQDR (28aa)
- FALLMTNCYATPSSNATDPLK (21aa)
- SQIQTPNPNQDQWSGQNAK (19aa)
- DQCIVDDITYNVNDTFHK (18aa)
- DVECGEGHFCHDNQTCCR (18aa)
- GQGEQGSTGGTNISSTSEPKEE (22aa)
- EPPPRTLPATDLQ (13aa)
- NQALNLSLAYSFVTPLTSMVVTK (23aa)
- MAEVIGSKLNISR (13aa)
- AVADTRDQADGSR (13aa)
- AVADTRDQADGSRASVDSGSSEEQGGSSR (29aa)
- ASVDSGSSEEQGGSSR (16aa)
- QQQHLFGSNVTDCSGNFCLFR (21aa)
- DQADGSRASVDSGSSEEQGGSSR (23aa)
- TVYLYPNQTGLPDPLSR (17aa)
- VVPDSTPSWANPSPTPVISMLAQGSQVLESTPPPHVMR (38aa)
- LAILPASATPATSNPDPAVSR (21aa)
- IEETTMTTQTPAPIQAPSAILPLPGQSVER (30aa)
- VLGPKDSK (8aa)
- DPQRFVVIQNEDLGPASPLDSTFYR (25aa)
- LDAPTNLQFVNETDSTVLVR (20aa)
- NYYADNQTCDGELLFNMTK (19aa)
- TAIFAFNISHVSNK (14aa)
- GQDSTIAASEQQVAAR (16aa)
- QSGDVTCNCTDGR (13aa)
Mass spectrometry observed peptide
-
- C-Linked / Undefined core
(avg mass : 180.1577)
- Urine (UBERON_0001088)
-
Non-secretory ribonuclease / Homo sapiens
- Undefined site
- Trp-34
-
- Free / Lactosamine
(avg mass : 716.6473)
- Urine (UBERON_0001088)
-
- Free / Lactosamine
(avg mass : 754.5905)
- Urine (UBERON_0001088)
-
- Free / Lactosamine
(avg mass : 754.5905)
- Urine (UBERON_0001088)
-
- Free / Lactosamine
(avg mass : 754.5905)
- Urine (UBERON_0001088)
-
- Free / Lactose
(avg mass : 488.4431)
- Urine (UBERON_0001088)
- Fucosidosis (DOID:14500)
-
- Free / Lactose
(avg mass : 633.558)
- Urine (UBERON_0001088)
-
- Free / Lactose
(avg mass : 633.558)
- Urine (UBERON_0001088)
-
- Free / Lactose
(avg mass : 675.5947)
- Urine (UBERON_0001088)
-
- Free / No-core
(avg mass : 309.2732)
- Urine (UBERON_0001088)
- Sialuria (DOID:3659)
-
- Free / No-core
(avg mass : 383.3527)
- Urine (UBERON_0001088)
- Mannosidosis, beta (DOID:3633)
-
- Free / No-core
(avg mass : 633.558)
- Urine (UBERON_0001088)
- Mannosidosis, beta (DOID:3633)
-
- Free / No-core
(avg mass : 674.6106)
- Urine (UBERON_0001088)
- Mannosidosis, beta (DOID:3633)
-
- Free / No-core
(avg mass : 1056.9755)
- Urine (UBERON_0001088)
- Fucosidosis (DOID:14500)
-
- Free / No-core
(avg mass : 1056.9755)
- Urine (UBERON_0001088)
- Fucosidosis (DOID:14500)
-
- Free / No-core
(avg mass : 1056.9755)
- Urine (UBERON_0001088)
- Fucosidosis (DOID:14500)
-
- Free / No-core
(avg mass : 1056.9755)
- Urine (UBERON_0001088)
- Fucosidosis (DOID:14500)
-
- Free / No-core
(avg mass : 1730.5983)
- Urine (UBERON_0001088)
- Fucosidosis (DOID:14500)
-
- Free / Truncated
(avg mass : 367.3533)
- Urine (UBERON_0001088)
- Fucosidosis (DOID:14500)
- Characterization and 400-MHz 1H-NMR analysis of urinary fucosyl glycoasparagines in fucosidosis. (1991 - Michalski J, Wieruszeski J, Alonso C, Cache P, Montreuil J, Strecker G) / Status : Reviewed
- Urinary oligosaccharides of fucosidosis. Evidence of the occurrence of X-antigenic determinant in serum-type sugar chains of glycoproteins. (1978 - Nishigaki M, Yamashita K, Matsuda I, Arashima S, Kobata A) / Status : Reviewed
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1276.1699)
- Urine (UBERON_0001088)
- Choriocarcinoma (DOID:3594)
- Choriocarcinoma, with Hyperthyroidism
- Diabetes Mellitus (DOID:9351)
- Hydatidiform Mole (DOID:3590)
- Hydatidiform Mole, Invasive (DOID:3590)
- Carbohydrate and peptide structure of the alpha- and beta-subunits of human chorionic gonadotropin from normal and aberrant pregnancy and choriocarcinoma. (1997 - Elliott M, Kardana A, Lustbader J, Cole L) / Status : Reviewed
- Rapid and simple approach for the NMR resonance assignment of the carbohydrate chains of an intact glycoprotein. Application of gradient-enhanced natural abundance 1H-13C HSQC and HSQC-TOCSY to the alpha-subunit of human chorionic gonadotropin. (1994 - de Beer T, van Zuylen C, Hard K, Boelens R, Kaptein R, Kamerling J, Vliegenthart J) / Status : Reviewed
- Altered glycosylation of human chorionic gonadotropin decreases its hormonal activity as determined by cyclic-adenosine 3',5'-monophosphate production in MA-10 cells. (1990 - Amano J, Nishimura R, Sato S, Kobata A) / Status : Reviewed
- Structures of the asparagine-linked sugar chains of human chorionic gonadotropin produced in choriocarcinoma. Appearance of triantennary sugar chains and unique biantennary sugar chains. (1983 - Mizuochi T, Nishimura R, Derappe C, Taniguchi T, Hamamoto T, Mochizuki M, Kobata A) / Status : Reviewed
-
Choriogonadotropin - alpha and beta chains / Homo sapiens
- Undefined site
-
Choriogonadotropin beta chain / Homo sapiens
- Undefined site
-
Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1276.1699)
- Urine (UBERON_0001088)
- Heavy Chain Disease (DOID:0060125)
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1317.2225)
- Urine (UBERON_0001088)
-
CD59 glycoprotein / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1364.2328)
- Urine (UBERON_0001088)
-
- N-Linked / Complex
(avg mass : 1364.2328)
- Urine (UBERON_0001088)
-
- N-Linked / Complex
(avg mass : 1406.3135)
- Urine (UBERON_0001088)
- Fucosidosis (DOID:14500)
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1406.3135)
- Urine (UBERON_0001088)
- Fucosidosis (DOID:14500)
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1422.3129)
- Urine (UBERON_0001088)
- Choriocarcinoma (DOID:3594)
- Fucosidosis (DOID:14500)
- Hydatidiform Mole, Invasive (DOID:3590)
- Characterization and 400-MHz 1H-NMR analysis of urinary fucosyl glycoasparagines in fucosidosis. (1991 - Michalski J, Wieruszeski J, Alonso C, Cache P, Montreuil J, Strecker G) / Status : Reviewed
- Altered glycosylation of human chorionic gonadotropin decreases its hormonal activity as determined by cyclic-adenosine 3',5'-monophosphate production in MA-10 cells. (1990 - Amano J, Nishimura R, Sato S, Kobata A) / Status : Reviewed
- Structures of the asparagine-linked sugar chains of human chorionic gonadotropin produced in choriocarcinoma. Appearance of triantennary sugar chains and unique biantennary sugar chains. (1983 - Mizuochi T, Nishimura R, Derappe C, Taniguchi T, Hamamoto T, Mochizuki M, Kobata A) / Status : Reviewed
-
Choriogonadotropin - alpha and beta chains / Homo sapiens
- Undefined site
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Urine (UBERON_0001088)
- Heavy Chain Disease (DOID:0060125)
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1567.4278)
- Urine (UBERON_0001088)
- Rapid and simple approach for the NMR resonance assignment of the carbohydrate chains of an intact glycoprotein. Application of gradient-enhanced natural abundance 1H-13C HSQC and HSQC-TOCSY to the alpha-subunit of human chorionic gonadotropin. (1994 - de Beer T, van Zuylen C, Hard K, Boelens R, Kaptein R, Kamerling J, Vliegenthart J) / Status : Reviewed
- Site-specific N-glycosylation of human chorionic gonadotrophin--structural analysis of glycopeptides by one- and two-dimensional 1H NMR spectroscopy. (1991 - Weisshaar G, Hiyama J, Renwick A) / Status : Reviewed
- Choriogonadotropin beta chain / Homo sapiens
- Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1567.4278)
- Urine (UBERON_0001088)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1567.4278)
- Urine (UBERON_0001088)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1568.4559)
- Urine (UBERON_0001088)
- Fucosidosis (DOID:14500)
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1568.4559)
- Urine (UBERON_0001088)
- Fucosidosis (DOID:14500)
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1568.4559)
- Urine (UBERON_0001088)
- Fucosidosis (DOID:14500)
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1641.5073)
- Urine (UBERON_0001088)
-
Major urinary protein / Mus musculus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1641.5073)
- Urine (UBERON_0001088)
-
Major urinary protein / Mus musculus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1641.5073)
- Urine (UBERON_0001088)
- Choriocarcinoma (DOID:3594)
- Choriocarcinoma, with Hyperthyroidism
- Diabetes Mellitus (DOID:9351)
- Carbohydrate and peptide structure of the alpha- and beta-subunits of human chorionic gonadotropin from normal and aberrant pregnancy and choriocarcinoma. (1997 - Elliott M, Kardana A, Lustbader J, Cole L) / Status : Reviewed
- Altered glycosylation of human chorionic gonadotropin decreases its hormonal activity as determined by cyclic-adenosine 3',5'-monophosphate production in MA-10 cells. (1990 - Amano J, Nishimura R, Sato S, Kobata A) / Status : Reviewed
- Structures of the asparagine-linked sugar chains of human chorionic gonadotropin produced in choriocarcinoma. Appearance of triantennary sugar chains and unique biantennary sugar chains. (1983 - Mizuochi T, Nishimura R, Derappe C, Taniguchi T, Hamamoto T, Mochizuki M, Kobata A) / Status : Reviewed
-
Choriogonadotropin - alpha and beta chains / Homo sapiens
- Undefined site
-
Choriogonadotropin beta chain / Homo sapiens
- Undefined site
-
Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1641.5073)
- Urine (UBERON_0001088)
- Anemia, Aplastic (DOID:12449)
- Choriocarcinoma (DOID:3594)
- Choriocarcinoma, with Hyperthyroidism
- Diabetes Mellitus (DOID:9351)
- Heavy Chain Disease (DOID:0060125)
- Hydatidiform Mole (DOID:3590)
- Hydatidiform Mole, Invasive (DOID:3590)
- Glycosylated major urinary protein of the house mouse: characterization of its N-linked oligosaccharides. (2000 - Mechref Y, Zidek L, Ma W, Novotny M) / Status : Reviewed
- Carbohydrate and peptide structure of the alpha- and beta-subunits of human chorionic gonadotropin from normal and aberrant pregnancy and choriocarcinoma. (1997 - Elliott M, Kardana A, Lustbader J, Cole L) / Status : Reviewed
- Rapid and simple approach for the NMR resonance assignment of the carbohydrate chains of an intact glycoprotein. Application of gradient-enhanced natural abundance 1H-13C HSQC and HSQC-TOCSY to the alpha-subunit of human chorionic gonadotropin. (1994 - de Beer T, van Zuylen C, Hard K, Boelens R, Kaptein R, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structural study on the glycosyl-phosphatidylinositol anchor and the asparagine-linked sugar chain of a soluble form of CD59 in human urine. (1994 - Nakano Y, Noda K, Endo T, Kobata A, Tomita M) / Status : Reviewed
- Altered glycosylation of human chorionic gonadotropin decreases its hormonal activity as determined by cyclic-adenosine 3',5'-monophosphate production in MA-10 cells. (1990 - Amano J, Nishimura R, Sato S, Kobata A) / Status : Reviewed
- Comparative structural study of N-linked oligosaccharides of urinary and recombinant erythropoietins. (1988 - Tsuda E, Goto M, Murakami A, Akai K, Ueda M, Kawanishi G, Takahashi N, Sasaki R, Chiba H, Ishihara H) / Status : Reviewed
- Comparative study of the asparagine-linked sugar chains of human erythropoietins purified from urine and the culture medium of recombinant Chinese hamster ovary cells. (1988 - Takeuchi M, Takasaki S, Miyazaki H, Kato T, Hoshi S, Kochibe N, Kobata A) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
- Structures of the asparagine-linked sugar chains of human chorionic gonadotropin produced in choriocarcinoma. Appearance of triantennary sugar chains and unique biantennary sugar chains. (1983 - Mizuochi T, Nishimura R, Derappe C, Taniguchi T, Hamamoto T, Mochizuki M, Kobata A) / Status : Reviewed
-
CD59 glycoprotein / Homo sapiens
- Undefined site
-
Choriogonadotropin - alpha and beta chains / Homo sapiens
- Undefined site
-
Choriogonadotropin beta chain / Homo sapiens
- Undefined site
-
Erythropoietin / Homo sapiens
- Undefined site
-
Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
-
Major urinary protein / Mus musculus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Urine (UBERON_0001088)
-
Glandular kallikrein 1 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1682.5599)
- Urine (UBERON_0001088)
-
Glandular kallikrein 1 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1713.5708)
- Urine (UBERON_0001088)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1713.5708)
- Urine (UBERON_0001088)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1723.6125)
- Urine (UBERON_0001088)
-
Glandular kallikrein 1 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1729.5702)
- Urine (UBERON_0001088)
-
- N-Linked / Complex
(avg mass : 1729.5702)
- Urine (UBERON_0001088)
-
- N-Linked / Complex
(avg mass : 1729.5702)
- Urine (UBERON_0001088)
-
- N-Linked / Complex
(avg mass : 1729.5702)
- Urine (UBERON_0001088)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1729.5702)
- Urine (UBERON_0001088)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1770.6228)
- Urine (UBERON_0001088)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1770.6228)
- Urine (UBERON_0001088)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1787.6503)
- Urine (UBERON_0001088)
- Choriocarcinoma (DOID:3594)
- Altered glycosylation of human chorionic gonadotropin decreases its hormonal activity as determined by cyclic-adenosine 3',5'-monophosphate production in MA-10 cells. (1990 - Amano J, Nishimura R, Sato S, Kobata A) / Status : Reviewed
- Structures of the asparagine-linked sugar chains of human chorionic gonadotropin produced in choriocarcinoma. Appearance of triantennary sugar chains and unique biantennary sugar chains. (1983 - Mizuochi T, Nishimura R, Derappe C, Taniguchi T, Hamamoto T, Mochizuki M, Kobata A) / Status : Reviewed
-
Choriogonadotropin - alpha and beta chains / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1787.6503)
- Urine (UBERON_0001088)
- Anemia, Aplastic (DOID:12449)
- Choriocarcinoma (DOID:3594)
- Choriocarcinoma, with Hyperthyroidism
- Diabetes Mellitus (DOID:9351)
- Hydatidiform Mole (DOID:3590)
- Hydatidiform Mole, Invasive (DOID:3590)
- Carbohydrate and peptide structure of the alpha- and beta-subunits of human chorionic gonadotropin from normal and aberrant pregnancy and choriocarcinoma. (1997 - Elliott M, Kardana A, Lustbader J, Cole L) / Status : Reviewed
- Structural study on the glycosyl-phosphatidylinositol anchor and the asparagine-linked sugar chain of a soluble form of CD59 in human urine. (1994 - Nakano Y, Noda K, Endo T, Kobata A, Tomita M) / Status : Reviewed
- Altered glycosylation of human chorionic gonadotropin decreases its hormonal activity as determined by cyclic-adenosine 3',5'-monophosphate production in MA-10 cells. (1990 - Amano J, Nishimura R, Sato S, Kobata A) / Status : Reviewed
- Comparative structural study of N-linked oligosaccharides of urinary and recombinant erythropoietins. (1988 - Tsuda E, Goto M, Murakami A, Akai K, Ueda M, Kawanishi G, Takahashi N, Sasaki R, Chiba H, Ishihara H) / Status : Reviewed
- Comparative study of the asparagine-linked sugar chains of human erythropoietins purified from urine and the culture medium of recombinant Chinese hamster ovary cells. (1988 - Takeuchi M, Takasaki S, Miyazaki H, Kato T, Hoshi S, Kochibe N, Kobata A) / Status : Reviewed
- Structures of the asparagine-linked sugar chains of human chorionic gonadotropin produced in choriocarcinoma. Appearance of triantennary sugar chains and unique biantennary sugar chains. (1983 - Mizuochi T, Nishimura R, Derappe C, Taniguchi T, Hamamoto T, Mochizuki M, Kobata A) / Status : Reviewed
-
CD59 glycoprotein / Homo sapiens
- Undefined site
-
Choriogonadotropin - alpha and beta chains / Homo sapiens
- Undefined site
-
Choriogonadotropin beta chain / Homo sapiens
- Undefined site
-
Erythropoietin / Homo sapiens
- Undefined site
-
Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1787.6503)
- Urine (UBERON_0001088)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1811.6754)
- Urine (UBERON_0001088)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1828.7029)
- Urine (UBERON_0001088)
-
Glandular kallikrein 1 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1869.7555)
- Urine (UBERON_0001088)
-
Glandular kallikrein 1 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1908.7671)
- Urine (UBERON_0001088)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1916.7658)
- Urine (UBERON_0001088)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1916.7658)
- Urine (UBERON_0001088)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1932.7652)
- Urine (UBERON_0001088)
Source
- N-Linked / Complex
(avg mass : 1932.7652)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1908.7671)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1869.7555)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1828.7029)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1811.6754)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1787.6503)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1787.6503)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1787.6503)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1770.6228)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1770.6228)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1729.5702)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1729.5702)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1729.5702)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1729.5702)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1729.5702)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1723.6125)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1713.5708)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1713.5708)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1682.5599)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1641.5073)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1641.5073)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1641.5073)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1641.5073)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1568.4559)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1568.4559)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1568.4559)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1567.4278)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1567.4278)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1567.4278)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1479.3649)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1422.3129)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1406.3135)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1406.3135)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1364.2328)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1364.2328)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1317.2225)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1276.1699)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1276.1699)
Source
Disease
Reference
Reported glycosite
- Free / Truncated
(avg mass : 367.3533)
Source
Disease
Reported glycosite
- Free / No-core
(avg mass : 1730.5983)
Source
Disease
Reported glycosite
- Free / No-core
(avg mass : 1056.9755)
Source
Disease
Reported glycosite
- Free / No-core
(avg mass : 1056.9755)
Source
Disease
Reported glycosite
- Free / No-core
(avg mass : 1056.9755)
Source
Disease
Reported glycosite
- Free / No-core
(avg mass : 1056.9755)
Source
Disease
Reported glycosite
- Free / No-core
(avg mass : 674.6106)
Source
Disease
Reported glycosite
- Free / No-core
(avg mass : 633.558)
Source
Disease
Reported glycosite
- Free / No-core
(avg mass : 383.3527)
Source
Disease
Reported glycosite
- Free / No-core
(avg mass : 309.2732)
Source
Reported glycosite
- Free / Lactose
(avg mass : 675.5947)
Source
Reported glycosite
- Free / Lactose
(avg mass : 633.558)
Source
Reported glycosite
- Free / Lactose
(avg mass : 633.558)
Source
Disease
Reported glycosite
- Free / Lactose
(avg mass : 488.4431)
Source
Reported glycosite
- Free / Lactosamine
(avg mass : 754.5905)
Source
Reported glycosite
- Free / Lactosamine
(avg mass : 754.5905)
Source
Reported glycosite
- Free / Lactosamine
(avg mass : 754.5905)
Source
Reported glycosite
- Free / Lactosamine
(avg mass : 716.6473)
Source
Reported glycosite
- C-Linked / Undefined core
(avg mass : 180.1577)