Structure

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Macaca mulatta (Rhesus monkey)
• Mus musculus (House mouse)
• Rattus norvegicus (Norway rat)
• Sus scrofa (Pig)
• Xenopus laevis (African clawed frog)
• Gallus gallus (Chicken)
• Rhea americana (Greater rhea)
• Sturnus vulgaris (Common starling)
• Human adenovirus type 5
• Human cytomegalovirus (strain 751)
• Human cytomegalovirus (strain ad169)
• Human cytomegalovirus (strain towne)
• Simian virus 40
• Entamoeba histolytica
• Leishmania major
• Plum pox virus (strain r)

Protein

• Actin-binding LIM protein 1 / Homo sapiens    O14639
• Alpha crystallin - a and b chains / Homo sapiens    P02511    P02489
• Alpha-synuclein / Homo sapiens    P37840
• Ankyrin-1 / Homo sapiens    P16157
• Ataxin-2-like protein / Homo sapiens    Q8WWM7
• Band 3 anion transport protein / Homo sapiens    P02730
• BRCA2-interacting transcriptional repressor EMSY / Homo sapiens    Q7Z589
• Carbonic anhydrase 1 / Homo sapiens    P00915
• Catalase / Homo sapiens    P04040
• CDKN2A-interacting protein / Homo sapiens    Q9NXV6
• Clathrin coat assembly protein AP180 / Homo sapiens    O60641
• Cyclin-dependent kinase 12 / Homo sapiens    Q9NYV4
• E3 SUMO-protein ligase RanBP2 / Homo sapiens    P49792
• Early growth response protein 1 / Homo sapiens    P18146
• Equilibrative nucleoside transporter 1 / Homo sapiens    Q99808
• Erythrocyte membrane protein band 4.2 / Homo sapiens    P16452
• Estrogen receptor / Homo sapiens    P03372
• Eukaryotic translation initiation factor 4 gamma 1 / Homo sapiens    Q04637
• F-actin-capping protein subunit alpha-3 / Homo sapiens    Q96KX2
• Forkhead box protein O1 / Homo sapiens    Q12778
• Glucocorticoid modulatory element-binding protein 2 / Homo sapiens    Q9UKD1
• Glutamine and serine-rich protein 1 / Homo sapiens    Q2KHR3
• Glutathione S-transferase omega-1 / Homo sapiens    P78417
• Hemoglobin subunit alpha / Homo sapiens    P69905
• Hemoglobin subunit beta / Homo sapiens    P68871
• Histone H3 / Homo sapiens    P68431
• Host Cell Factor 1 / Homo sapiens    P51610
• Inhibitor of nuclear factor kappa-B kinase subunit beta / Homo sapiens    O14920
• KAT8 regulatory NSL complex subunit 3 / Homo sapiens    Q9P2N6
• Keratin, type I cytoskeletal 13 / Homo sapiens    P13646
• Keratin, type i cytoskeletal 18 / Homo sapiens    P05783
• Keratin, type II cytoskeletal 8 / Homo sapiens    P05787
• MAX gene-associated protein / Homo sapiens    Q8IWI9
• Microtubule-associated protein tau / Homo sapiens    P10636
• Msx2-interacting protein / Homo sapiens    Q96T58
• Myc proto-oncogene protein / Homo sapiens    P01106
• Myocyte-specific enhancer factor 2D / Homo sapiens    Q14814
• Neuroblast differentiation-associated protein AHNAK / Homo sapiens    Q09666
• Nuclear envelope pore membrane protein POM 121 / Homo sapiens    Q96HA1
• Nuclear factor related to kappa-B-binding protein / Homo sapiens    Q6P4R8
• Nuclear mitotic apparatus protein 1 / Homo sapiens    Q14980
• Nuclear pore complex protein Nup153 / Homo sapiens    P49790
• Nuclear pore complex protein Nup214 / Homo sapiens    P35658
• Nuclear pore complex protein Nup98-Nup96 isoform 4 / Homo sapiens    P52948-4
• Nuclear receptor corepressor 1 / Homo sapiens    O75376
• Nucleoporin p62 / Homo sapiens    P37198
• Nucleoprotein TPR / Homo sapiens    P12270
• Nucleosome-remodeling factor subunit BPTF / Homo sapiens    Q12830
• PDZ and LIM domain protein 7 isoform 4 / Homo sapiens    Q9NR12-4
• Perilipin-4 / Homo sapiens    Q96Q06
• Pleckstrin homology domain containing, family A member 5 / Homo sapiens    Q9HAU0
• Pogo transposable element with ZNF domain isoform 2 / Homo sapiens    Q7Z3K3-2
• Polyhomeotic-like protein 3 / Homo sapiens    Q8NDX5
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Prelamin-A/C isoform 3 / Homo sapiens    P02545-3
• Protein 4.1 / Homo sapiens    P11171
• Protein lin-54 homolog / Homo sapiens    Q6MZP7
• Protein PRRC2C / Homo sapiens    Q9Y520
• Protein SON / Homo sapiens    P18583-1
• Protein strawberry notch homolog 1 / Homo sapiens    A3KN83
• RanBP2-like and GRIP domain-containing protein 4 / Homo sapiens    Q7Z3J3
• Ras-associated and pleckstrin homology domains-containing protein 1 / Homo sapiens    Q70E73
• Regulation of nuclear pre-mRNA domain-containing protein 2 / Homo sapiens    Q5VT52
• Ribosomal RNA processing protein 1 homolog B / Homo sapiens    Q14684
• RNA binding motif protein 27 / Homo sapiens    Q9P2N5
• RNA-binding protein 14 / Homo sapiens    Q96PK6
• Serine/arginine repetitive matrix protein 2 / Homo sapiens    Q9UQ35
• Serine/threonine-protein kinase WNK1 / Homo sapiens    Q9H4A3
• Serum response factor (srf) / Homo sapiens    P11831
• Solute carrier family 2, facilitated glucose transporter, member 1 / Homo sapiens    P11166
• Spectrin alpha chain, erythrocytic 1 / Homo sapiens    P02549
• Spectrin beta chain, erythrocytic / Homo sapiens    P11277
• Synaptopodin / Homo sapiens    Q8N3V7
• TBP-associated factor 4 / Homo sapiens    O00268
• Transcription factor sp1 / Homo sapiens    P08047
• Transcriptional repressor p66-beta / Homo sapiens    Q8WXI9
• Ubiquitin-associated protein 2-like / Homo sapiens    Q14157
• Uncharacterized protein from Erythrocyte / Homo sapiens    
• Vimentin / Homo sapiens    P08670
• YTH domain-containing family protein 1 / Homo sapiens    Q9BYJ9
• YTH domain-containing family protein 3 / Homo sapiens    Q7Z739
• Zinc finger CCCH domain-containing protein 14 isoform 2 / Homo sapiens    Q6PJT7-2
• Zinc finger protein 281 / Homo sapiens    Q9Y2X9
• Zinc finger protein 40 / Homo sapiens    P15822
• Zinc finger RNA-binding protein / Homo sapiens    Q96KR1
• Zinc fingers and homeoboxes protein 1 / Homo sapiens    Q9UKY1
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Alpha crystallin - a and b chains / Bos taurus    P02510    P02470
• Alpha crystallin a chain (a1 subunit) / Bos taurus    P02470
• Alpha crystallin a chain (a2 subunit) / Bos taurus    P02470
• Alpha crystallin b chain (b1 subunit) / Bos taurus    P02510
• Alpha crystallin b chain (b2 subunit) / Bos taurus    P02510
• Ankyrin 3 / Bos taurus    E1BNC9
• Estrogen receptor / Bos taurus    P49884
• Mucin / Bos taurus    
• Synapsin-1 / Bos taurus    P17599
• Alpha crystallin - a and b chains / Macaca mulatta    P02488
• Estrogen receptor / Mus musculus    P19785
• Estrogen receptor beta / Mus musculus    O08537
• Nucleoporin p62 / Mus musculus    
• Uncharacterized protein from B-Lymphocyte / Mus musculus    
• Uncharacterized protein from T-Lymphocyte / Mus musculus    
• Uncharacterized protein from Thymocyte / Mus musculus    
• 56 kDa intrinsic membrane protein / Rattus norvegicus    
• Alpha crystallin - a and b chains / Rattus norvegicus    P23928    P24623
• Neurofilament triplet l protein / Rattus norvegicus    P19527
• Neurofilament triplet m protein / Rattus norvegicus    P12839
• Nuclear pore glycoprotein p62 / Rattus norvegicus    P17955
• Uncharacterized protein from Cell Nuclei / Rattus norvegicus    
• Uncharacterized protein from Liver / Rattus norvegicus    
• Uncharacterized protein from Nucleus / Rattus norvegicus    
• Talin-1 / Sus scrofa    F1SFZ8
• Nucleoporin p62 / Xenopus laevis    
• Talin / Gallus gallus    P54939
• Alpha crystallin - a and b chains / Rhea americana    P02505
• Alpha crystallin / Sturnus vulgaris    
• Fiber protein / Human adenovirus type 5    P11818
• Large structural phosphoprotein / Human cytomegalovirus (strain 751)    
• Large structural phosphoprotein / Human cytomegalovirus (strain ad169)    P08318
• Large structural phosphoprotein / Human cytomegalovirus (strain towne)    
• Large t antigen / Simian virus 40    P03070
• Serine-rich 25 kDa antigen protein / Entamoeba histolytica    P21138
• Glycoprotein 96-92 / Leishmania major    Q4Q843
• Coat protein / Plum pox virus (strain r)    

Source

• Anterior Lobe of Cerebellum (UBERON_0002131)  
• Brain (UBERON_0000955)   C-1300 clone N18 (CVCL_4724)  
• Brain (UBERON_0000955)   C-1300 clone S20 (CVCL_VU14)  
• Brain (UBERON_0000955)   NB41A3 (CVCL_3553)  
• Brain (UBERON_0000955)   Neuro-2a (CVCL_0470)  
• Brain (UBERON_0000955)  
• Brain (UBERON_0000955)   Nucleus (GO_0005634)  
• Colon (UBERON_0001155)   HT-29 (CVCL_0320)  
• Frontal Cortex (UBERON_0001870)  
• Gizzard Smooth Muscle (UBERON_0011903)  
• Kidney (UBERON_0002113)   COS-7 (CVCL_0224)  
• Kidney (UBERON_0002113)   CV-1 (CVCL_0229)  
• Kidney (UBERON_0002113)   NRK (CVCL_3758)  
• Lens of Camera-Type Eye (UBERON_0000965)  
• Liver (UBERON_0002107)   BRL (CVCL_4565)   Nucleus (GO_0005634)  
• Liver (UBERON_0002107)  
• Liver (UBERON_0002107)   Nucleus (GO_0005634)  
• Lung (UBERON_0002048)   Nucleus (GO_0005634)  
• Mammalian Vulva (UBERON_0000997)   A-431 (CVCL_0037)  
• Mammary Gland (UBERON_0001911)   MCF-7 (CVCL_0031)  
• Middle Frontal Gyrus (UBERON_0002702)  
• Milk (UBERON_0001913)  
• Myocardium (UBERON_0002349)   Nucleus (GO_0005634)  
• Outer Epithelium (UBERON_0007376)   Foreskin Keratinocyte (CL_1001606)  
• Ovary (UBERON_0000992)   Sf9 (CVCL_0549)  
• Prepuce of Penis (UBERON_0001332)   Fibroblast (CL_0000057)  
• Stomach Smooth Muscle (UBERON_0004222)  
• Submandibular Gland (UBERON_0001736)  
• Thymus (UBERON_0002370)   Platelet (CL_0000233)  
• Uterine Cervix (UBERON_0000002)   Detroit 98/AH-2 (CVCL_8190)  
• Uterine Cervix (UBERON_0000002)   HeLa (CVCL_0030)   Fibroblast (CL_0000057)  
• Uterine Cervix (UBERON_0000002)   HeLa (CVCL_0030)  
• Uterus (UBERON_0000995)  
• HEK293 (CVCL_0045)  
• HeLa (CVCL_0030)  
• B-Lymphocyte (CL_0000236)  
• Egg Cell  
• Erythrocyte (CL_0000232)  
• Fibroblast (CL_0000057)  
• T-Lymphocyte (CL_0000084)  
• Cytoplasm (GO_0005737)  
• Cytoplasmic Vesicle (GO_0031410)  
• Neurofilament (GO_0005883)  
• Node of Ranvier (GO_0033268)  
• Nucleus (GO_0005634)  

Reported structure

• O-Linked / Undefined core / GlcNAc(b

Composition

• HexNAc:1 (avg mass : 221.2103 )

Disease

• Adenocarcinoma (DOID:299)
• Adenocarcinoma, Grade II (DOID:299)
• Alzheimer's disease (DOID:10652)
• Carcinoma (DOID:305)
• Carcinoma, Squamous cell (DOID:1749)
• Diabetes Mellitus, Non-insulin dependent (DOID:9352)
• Malaria Tropica, Malignant (DOID:14067)
• Neuroblastoma (DOID:769)

Reference

• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Electron Transfer Dissociation (ETD): The Mass Spectrometric Breakthrough Essential for O-GlcNAc Protein Site Assignments-A Study of the O-GlcNAcylated Protein Host Cell Factor C1 (2013 - Samuel A Myers, Salima Daou, El Bachir Affar, Al Burlingame) / Status : Reviewed
• Modification of Histones by Sugar β-N-acetylglucosamine (GlcNAc) Occurs on Multiple Residues, Including Histone H3 Serine 10, and Is Cell Cycle-Regulated (2011 - Suisheng Zhang, Kevin Roche, Heinz-Peter Nasheuer, Noel Francis Lowndes) / Status : Reviewed
• Mapping O-GlcNAc modification sites on tau and generation of a site-specific O-GlcNAc tau antibody (2011 - Scott A Yuzwa, Anuj K Yadav, Yuliya Skorobogatko, Thomas Clark, Keith Vosseller, David J Vocadlo) / Status : Unreviewed
• Identification of O-GlcNAc sites within peptides of the Tau protein and their impact on phosphorylation (2011 - Caroline Smet-Nocca, Malgorzata Broncel, Jean-Michel Wieruszeski, Caroline Tokarski, Xavier Hanoulle, Arnaud Leroy, Isabelle Landrieu, Christian Rolando, Guy Lippens, Christian P R Hackenberger) / Status : Unreviewed
• Extensive Crosstalk Between O-GlcNAcylation and Phosphorylation Regulates Cytokinesis (2010 - Zihao Wang, Namrata D Udeshi, Chad Slawson, Philip D Compton, Kaoru Sakabe, Win D Cheung, Jeffrey Shabanowitz, Donald F Hunt, Gerald W Hart) / Status : Reviewed
• Site-specific GlcNAcylation of Human Erythrocyte Proteins: Potential Biomarker(s) for Diabetes (2009 - Zihao Wang, Kyoungsook Park, Frank Comer, Linda C Hsieh-Wilson, Christopher D Saudek, Gerald W Hart) / Status : Reviewed
• Loss of p53 Enhances Catalytic Activity of IKKbeta Through O-linked beta-N-acetyl Glucosamine Modification (2009 - Keiko Kawauchi, Keigo Araki, Kei Tobiume, Nobuyuki Tanaka) / Status : Reviewed
• O-GlcNAc Regulates FoxO Activation in Response to Glucose (2008 - Michael P Housley, Joseph T Rodgers, Namrata D Udeshi, Timothy J Kelly, Jeffrey Shabanowitz, Donald F Hunt, Pere Puigserver, Gerald W Hart) / Status : Reviewed
• The capsid protein of a plant single-stranded RNA virus is modified by O-linked N-acetylglucosamine (2002 - Fernandez-Fernandez, Camafeita, Bonay, Mendez, Albar, Garcia) / Status : Reviewed
• Alternative O-glycosylation/O-phosphorylation of the murine estrogen receptor beta. (2000 - Cheng X, Cole R, Zaia J, Hart G) / Status : Reviewed
• An evaluation of sialation of the nucleoporin p62. (1998 - Fang B, Hanover J, Miller M) / Status : Reviewed
• Neutral core oligosaccharides of bovine submaxillary mucin--use of lead tetraacetate in the cold for establishing branch positions. (1998 - Martensson S, Levery S, Fang T, Bendiak B) / Status : Reviewed
• Reduction of O-linked N-acetylglucosamine-modified assembly protein-3 in Alzheimer's disease. (1998 - Yao P, Coleman P) / Status : Reviewed
• SV40 large T antigen is modified with O-linked N-acetylglucosamine but not with other forms of glycosylation. (1998 - Medina L, Grove K, Haltiwanger R) / Status : Reviewed
• A subpopulation of estrogen receptors are modified by O-linked N-acetylglucosamine. (1997 - Jiang M, Hart G) / Status : Reviewed
• Identification of O-linked N-acetylglucosamine modification of ankyrinG isoforms targeted to nodes of Ranvier. (1996 - Zhang X, Bennett V) / Status : Reviewed
• The serine-rich Entamoeba histolytica protein is a phosphorylated membrane protein containing O-linked terminal N-acetylglucosamine residues. (1995 - Stanley Jr S, Tian K, Koester J, Li E) / Status : Reviewed
• c-Myc is glycosylated at threonine 58, a known phosphorylation site and a mutational hot spot in lymphomas. (1995 - Chou T, Hart G, Dang C) / Status : Reviewed
• Identification and mutational analysis of the glycosylation sites of human keratin 18. (1995 - Ku N, Omary M) / Status : Reviewed
• Site-specific glycosylation of the human cytomegalovirus tegument basic phosphoprotein (UL32) at serine 921 and serine 952. (1994 - Greis K, Gibson W, Hart G) / Status : Reviewed
• Identification, characterisation and genomic cloning of a O-linked N-acetylglucosamine-containing cytoplasmic Leishmania glycoprotein. (1993 - Handman E, Barnett L, Osborn A, Goding J, Murray P) / Status : Reviewed
• Glycosylation of mammalian neurofilaments. Localization of multiple O-linked N-acetylglucosamine moieties on neurofilament polypeptides L and M. (1993 - Dong D, Xu Z, Chevrier M, Cotter R, Cleveland D, Hart G) / Status : Reviewed
• Studies on O-glycans of Plasmodium-falciparum-infected human erythrocytes. Evidence for O-GlcNAc and O-GlcNAc-transferase in malaria parasites. (1993 - Dieckmann-Schuppert A, Bause E, Schwarz R) / Status : Reviewed
• The cytoskeletal protein talin is O-glycosylated. (1992 - Hagmann J, Grob M, Burger M) / Status : Reviewed
• Vertebrate lens alpha-crystallins are modified by O-linked N-acetylglucosamine. (1992 - Roquemore E, Dell A, Morris H, Panico M, Reason A, Savoy L, Wistow G, Zigler J, Earles B, Hart G) / Status : Reviewed
• Synapsins contain O-linked N-acetylglucosamine. (1991 - Luthi T, Haltiwanger R, Greengard P, Bahler M) / Status : Reviewed
• Lymphocyte activation induces rapid changes in nuclear and cytoplasmic glycoproteins. (1991 - Kearse KP, Hart GW) / Status : Reviewed
• Identification of O-GlcNAc attachment sites in transcription factors. (1991 - Reason A, Dell A, Morris H, Panico M, Treisman R, Marais R, Hart G, Haltiwanger R) / Status : Reviewed
• Bovine lens alpha-crystalline subunits are modified by O-linked GlcNAc. (1991 - Roquemore E, Dell A, Hart G) / Status : Reviewed
• Characterization and dynamics of O-linked glycosylation of human cytokeratin 8 and 18. (1991 - Chou C, Smith A, Omary M) / Status : Reviewed
• Nuclear localization of an O-glycosylated protein phosphotyrosine phosphatase from human cells. (1991 - Meikrantz W, Smith D, Sladicka M, Schlegel R) / Status : Reviewed
• Relative accessibility of N-acetylglucosamine in trimers of the adenovirus types 2 and 5 fiber proteins. (1990 - Mullis K, Haltiwanger R, Hart G, Marchase R, Engler J) / Status : Reviewed
• Cytokeratin 13 contains O-glycosidically linked N-acetylglucosamine residues. (1989 - King I, Hounsell E) / Status : Reviewed
• O-N-acetyl-D-glucosamine Moiety on Discrete Peptide of Multiple Protein 4.1 Isoforms Regulated by Alternative Pathways (1989 - M Inaba, Y Maede) / Status : Reviewed
• O-glycosylation of eukaryotic transcription factors: implications for mechanisms of transcriptional regulation. (1988 - Jackson S, Tjian R) / Status : Reviewed
• Intrinsic membrane glycoproteins with cytosol-oriented sugars in the endoplasmic reticulum. (1988 - Abeijon C, Hirschberg C) / Status : Reviewed
• Virion basic phosphoprotein from human cytomegalovirus contains O-linked N-acetylglucosamine. (1988 - Benko D, Haltiwanger R, Hart G, Gibson W) / Status : Reviewed
• Nuclear pore complex glycoproteins contain cytoplasmically disposed O-linked N-acetylglucosamine. (1987 - Holt G, Snow C, Senior A, Haltiwanger R, Gerace L, Hart G) / Status : Reviewed
• A nuclear specific glycoprotein representative of a unique pattern of glycosylation. (1987 - Schindler M, Hogan M, Miller R, DeGaetano D) / Status : Reviewed
• Nuclear pore complex contains a family of glycoproteins that includes p62: glycosylation through a previously unidentified cellular pathway. (1987 - Davis L, Blobel G) / Status : Reviewed
• Erythrocytes contain cytoplasmic glycoproteins. O-linked GlcNAc on Band 4.1. (1987 - Holt G, Haltiwanger R, Torres C, Hart G) / Status : Reviewed
• Topography and polypeptide distribution of terminal N-acetylglucosamine residues on the surfaces of intact lymphocytes. Evidence for O-linked GlcNAc. (1984 - Torres C, Hart G) / Status : Reviewed

Reported glycosite

• Actin-binding LIM protein 1 / Homo sapiens
  •        Ser-452
• Alpha crystallin - a and b chains / Homo sapiens
  •        Undefined site
• Alpha-synuclein / Homo sapiens
  •        Ser-87
• Ankyrin-1 / Homo sapiens
  •        Ser-288
  •        Ser-794
  •        Ser-960
  •        Ser-1162
• Ataxin-2-like protein / Homo sapiens
  •        Ser-678
  •        Ser-684
• Band 3 anion transport protein / Homo sapiens
  •        Ser-162
  •        Ser-224
  •        Ser-745
• BRCA2-interacting transcriptional repressor EMSY / Homo sapiens
  •        Ser-228
  •        Ser-236
  •        Thr-271
  •        Thr-501
  •        Thr-506
  •        Thr-534
  •        Thr-535
  •        Ser-557
  •        Thr-1120
• Carbonic anhydrase 1 / Homo sapiens
  •        Ser-130
  •        Ser-218
• Catalase / Homo sapiens
  •        Ser-114
  •        Ser-254
• CDKN2A-interacting protein / Homo sapiens
  •        Thr-323
  •        Ser-349
  •        Thr-379
• Clathrin coat assembly protein AP180 / Homo sapiens
  •        Undefined site
• Cyclin-dependent kinase 12 / Homo sapiens
  •        Thr-592
  •        Ser-597
• E3 SUMO-protein ligase RanBP2 / Homo sapiens
  •        Thr-1399
• Early growth response protein 1 / Homo sapiens
  •        Thr-119
• Equilibrative nucleoside transporter 1 / Homo sapiens
  •        Ser-63
• Erythrocyte membrane protein band 4.2 / Homo sapiens
  •        Ser-82
• Estrogen receptor / Homo sapiens
  •        Undefined site
• Eukaryotic translation initiation factor 4 gamma 1 / Homo sapiens
  •        Ser-61
• F-actin-capping protein subunit alpha-3 / Homo sapiens
  •        Thr-2
• Forkhead box protein O1 / Homo sapiens
  •        Thr-317
  •        Ser-550
  •        Thr-648
  •        Ser-654
• Glucocorticoid modulatory element-binding protein 2 / Homo sapiens
  •        Thr-404
• Glutamine and serine-rich protein 1 / Homo sapiens
  •        Thr-104
  •        Ser-105
• Glutathione S-transferase omega-1 / Homo sapiens
  •        Ser-13
• Hemoglobin subunit alpha / Homo sapiens
  •        Ser-4
  •        Ser-36
  •        Ser-134
• Hemoglobin subunit beta / Homo sapiens
  •        Ser-50
  •        Ser-73
  •        Thr-85
• Histone H3 / Homo sapiens
  •        Ser-11
• Host Cell Factor 1 / Homo sapiens
  •        Thr-490
  •        Thr-495
  •        Ser-562
  •        Ser-563
  •        Ser-569
  •        Thr-579
  •        Ser-620
  •        Ser-622
  •        Ser-623
  •        Thr-625
  •        Thr-651
  •        Thr-652
  •        Ser-685
  •        Thr-694
  •        Thr-726
  •        Thr-739
  •        Thr-760
  •        Thr-779
  •        Thr-801
  •        Ser-806
  •        Thr-808
  •        Thr-861
  •        Thr-1030
  •        Thr-1031
  •        Thr-1143
  •        Ser-1150
  •        Thr-1239
  •        Thr-1273
  •        Thr-1335
  •        Thr-1743
• Inhibitor of nuclear factor kappa-B kinase subunit beta / Homo sapiens
  •        Ser-733
• KAT8 regulatory NSL complex subunit 3 / Homo sapiens
  •        Thr-860
• Keratin, type I cytoskeletal 13 / Homo sapiens
  •        Undefined site
• Keratin, type i cytoskeletal 18 / Homo sapiens
  •        Ser-30
  •        Ser-49
• Keratin, type II cytoskeletal 8 / Homo sapiens
  •        Undefined site
  •        Ser-13
  •        Ser-15
• MAX gene-associated protein / Homo sapiens
  •        Ser-1557
• Microtubule-associated protein tau / Homo sapiens
  •        Thr-123
  •        Ser-208
  •        Ser-238
  •        Ser-400
  •        Ser-409/Ser-412/Ser-413
  •        Ser-489
• Msx2-interacting protein / Homo sapiens
  •        Thr-2529
  •        Ser-2530
  •        Ser-2811
  •        Thr-2924
• Myc proto-oncogene protein / Homo sapiens
  •        Thr-58
• Myocyte-specific enhancer factor 2D / Homo sapiens
  •        Ser-275
• Neuroblast differentiation-associated protein AHNAK / Homo sapiens
  •        Ser-5603
• Nuclear envelope pore membrane protein POM 121 / Homo sapiens
  •        Thr-693
  •        Ser-694
  •        Ser-738
• Nuclear factor related to kappa-B-binding protein / Homo sapiens
  •        Thr-750
  •        Thr-841
• Nuclear mitotic apparatus protein 1 / Homo sapiens
  •        Ser-1844
• Nuclear pore complex protein Nup153 / Homo sapiens
  •        Ser-534
  •        Ser-544
  •        Ser-908
  •        Ser-909
  •        Thr-1112
  •        Thr-1156
  •        Thr-1179
  •        Thr-1180
• Nuclear pore complex protein Nup214 / Homo sapiens
  •        Thr-580
  •        Ser-1056
  •        Thr-1201
  •        Ser-1354
• Nuclear pore complex protein Nup98-Nup96 isoform 4 / Homo sapiens
  •        Thr-184
  •        Thr-567
  •        Thr-568
• Nuclear receptor corepressor 1 / Homo sapiens
  •        Ser-1487
• Nucleoporin p62 / Homo sapiens
  •        Undefined site
• Nucleoprotein TPR / Homo sapiens
  •        Ser-1676
• Nucleosome-remodeling factor subunit BPTF / Homo sapiens
  •        Ser-1749
  •        Thr-1753
  •        Ser-2081
  •        Thr-2094
  •        Thr-2103
• PDZ and LIM domain protein 7 isoform 4 / Homo sapiens
  •        Ser-89
• Perilipin-4 / Homo sapiens
  •        Ser-704
• Pleckstrin homology domain containing, family A member 5 / Homo sapiens
  •        Ser-382
• Pogo transposable element with ZNF domain isoform 2 / Homo sapiens
  •        Ser-191
• Polyhomeotic-like protein 3 / Homo sapiens
  •        Thr-283
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-499
• Prelamin-A/C isoform 3 / Homo sapiens
  •        Ser-582
  •        Thr-613
• Protein 4.1 / Homo sapiens
  •        Undefined site
  •        Ser-491
  •        Ser-792
• Protein lin-54 homolog / Homo sapiens
  •        Ser-238
• Protein PRRC2C / Homo sapiens
  •        Thr-2243
  •        Thr-2693
• Protein SON / Homo sapiens
  •        Thr-252
  •        Thr-253
• Protein strawberry notch homolog 1 / Homo sapiens
  •        Thr-112
• RanBP2-like and GRIP domain-containing protein 4 / Homo sapiens
  •        Ser-919
• Ras-associated and pleckstrin homology domains-containing protein 1 / Homo sapiens
  •        Thr-784
• Regulation of nuclear pre-mRNA domain-containing protein 2 / Homo sapiens
  •        Ser-399
  •        Thr-400
• Ribosomal RNA processing protein 1 homolog B / Homo sapiens
  •        Ser-731
• RNA binding motif protein 27 / Homo sapiens
  •        Ser-546
  •        Ser-738
• RNA-binding protein 14 / Homo sapiens
  •        Ser-244
  •        Ser-254
  •        Ser-256
  •        Ser-280
• Serine/arginine repetitive matrix protein 2 / Homo sapiens
  •        Ser-2236
• Serine/threonine-protein kinase WNK1 / Homo sapiens
  •        Undefined site
• Serum response factor (srf) / Homo sapiens
  •        Ser-277
  •        Ser-316
• Solute carrier family 2, facilitated glucose transporter, member 1 / Homo sapiens
  •        Ser-465
• Spectrin alpha chain, erythrocytic 1 / Homo sapiens
  •        Ser-844
  •        Ser-1250
  •        Ser-1737
• Spectrin beta chain, erythrocytic / Homo sapiens
  •        Ser-671
  •        Ser-767
  •        Ser-1297
  •        Ser-1652
  •        Ser-1936
• Synaptopodin / Homo sapiens
  •        Ser-165
• TBP-associated factor 4 / Homo sapiens
  •        Ser-528
• Transcription factor sp1 / Homo sapiens
  •        Undefined site
• Transcriptional repressor p66-beta / Homo sapiens
  •        Ser-584
• Ubiquitin-associated protein 2-like / Homo sapiens
  •        Thr-782
  •        Thr-783
• Uncharacterized protein from Erythrocyte / Homo sapiens
  •        Undefined site
• Vimentin / Homo sapiens
  •        Ser-7
  •        Thr-33
  •        Ser-34
• YTH domain-containing family protein 1 / Homo sapiens
  •        Ser-196
• YTH domain-containing family protein 3 / Homo sapiens
  •        Thr-205
• Zinc finger CCCH domain-containing protein 14 isoform 2 / Homo sapiens
  •        Thr-369
• Zinc finger protein 281 / Homo sapiens
  •        Ser-891
• Zinc finger protein 40 / Homo sapiens
  •        Thr-2325
• Zinc finger RNA-binding protein / Homo sapiens
  •        Ser-148
  •        Thr-149
  •        Ser-195
  •        Thr-202
• Zinc fingers and homeoboxes protein 1 / Homo sapiens
  •        Ser-450
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-112
• Alpha crystallin - a and b chains / Bos taurus
  •        Ser-162
• Alpha crystallin a chain (a1 subunit) / Bos taurus
  •        Ser-162
• Alpha crystallin a chain (a2 subunit) / Bos taurus
  •        Ser-162
• Alpha crystallin b chain (b1 subunit) / Bos taurus
  •        Undefined site
• Alpha crystallin b chain (b2 subunit) / Bos taurus
  •        Undefined site
• Ankyrin 3 / Bos taurus
  •        Undefined site
• Estrogen receptor / Bos taurus
  •        Undefined site
• Mucin / Bos taurus
  •        Undefined site
• Synapsin-1 / Bos taurus
  •        Undefined site
• Alpha crystallin - a and b chains / Macaca mulatta
  •        Undefined site
• Estrogen receptor / Mus musculus
  •        Thr-575
• Estrogen receptor beta / Mus musculus
  •        Undefined site
  •        Ser-61
• Nucleoporin p62 / Mus musculus
  •        Undefined site
• Uncharacterized protein from B-Lymphocyte / Mus musculus
  •        Undefined site
• Uncharacterized protein from T-Lymphocyte / Mus musculus
  •        Undefined site
• Uncharacterized protein from Thymocyte / Mus musculus
  •        Undefined site
• 56 kDa intrinsic membrane protein / Rattus norvegicus
  •        Undefined site
• Alpha crystallin - a and b chains / Rattus norvegicus
  •        Undefined site
• Neurofilament triplet l protein / Rattus norvegicus
  •        Thr-21
  •        Ser-27
• Neurofilament triplet m protein / Rattus norvegicus
  •        Thr-48
  •        Thr-431
• Nuclear pore glycoprotein p62 / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Cell Nuclei / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Liver / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Nucleus / Rattus norvegicus
  •        Undefined site
• Talin-1 / Sus scrofa
  •        Undefined site
• Nucleoporin p62 / Xenopus laevis
  •        Undefined site
• Talin / Gallus gallus
  •        Thr-18
  •        Thr-27
• Alpha crystallin - a and b chains / Rhea americana
  •        Undefined site
• Alpha crystallin / Sturnus vulgaris
  •        Undefined site
• Fiber protein / Human adenovirus type 5
  •        Undefined site
• Large structural phosphoprotein / Human cytomegalovirus (strain 751)
  •        Undefined site
• Large structural phosphoprotein / Human cytomegalovirus (strain ad169)
  •        Ser-921
  •        Ser-952
• Large structural phosphoprotein / Human cytomegalovirus (strain towne)
  •        Undefined site
• Large t antigen / Simian virus 40
  •        Undefined site
• Serine-rich 25 kDa antigen protein / Entamoeba histolytica
  •        Undefined site
• Glycoprotein 96-92 / Leishmania major
  •        Undefined site
• Coat protein / Plum pox virus (strain r)
  •        Undefined site

Mass spectrometry observed peptide

• TLSVLSR (7aa)
  •    Q96KX2    Thr-2
• VLSPADK (7aa)
  •    P69905    Ser-4
• SVSSSSYR (8aa)
  •    P08670    Ser-7
• QTARKSTGGKAP (12aa)
  •    P68431    Ser-11
• GSAPPGPVPEGSIR (14aa)
  •    P78417    Ser-13
• VSTSGPR (7aa)
  •    P05787    Ser-15
  •    P05787    Ser-13
• RYVETPR (7aa)
  •    P19527    Thr-21
• VHISSVR (7aa)
  •    P19527    Ser-27
• SYVTTSTR (8aa)
  •    P08670    Thr-33
  •    P08670    Ser-34
• MFLSFPTTK (9aa)
  •    P69905    Ser-36
• GSPSTVSSSYK (11aa)
  •    P12839    Thr-48
• FFESFGDLSTPDAVMGNPK (19aa)
  •    P68871    Ser-50
• AQPPSSAASR (10aa)
  •    Q04637    Ser-61
• DAQASAAPAAPLPER (15aa)
  •    Q99808    Ser-63
• VLGAFSDGLAHLDNLK (16aa)
  •    P68871    Ser-73
• TQATFPISSLGDR (13aa)
  •    P16452    Ser-82
• GTFATLSELHCDK (13aa)
  •    P68871    Thr-85
• KTVEGAGSIAAATGFVKK (18aa)
  •    P37840    Ser-87
• AQPVQSK (7aa)
  •    Q9NR12-4    Ser-89
• TSQGTVPTALAFER (14aa)
  •    Q2KHR3    Ser-105
  •    Q2KHR3    Thr-104
• KDIVEYYNDSNGSHVLQGRFGCEIENNRS (29aa)
  •    P25311    Asn-112
• TPPVTTNR (8aa)
  •    A3KN83    Thr-112
• FSTVAGESGSADTVR (15aa)
  •    P04040    Ser-114
• VLVETSYPSQTTR (13aa)
  •    P18146    Thr-119
• DTPSLEDEAAGHVTQAR (17aa)
  •    P10636    Thr-123
• YSSLAEAASK (10aa)
  •    P00915    Ser-130
• FLASVSTVLTSK (12aa)
  •    P69905    Ser-134
• STAPAVAYDSK (11aa)
  •    Q96KR1    Thr-149
  •    Q96KR1    Ser-148
• HSHAGELEALGGVKPAVLTR (20aa)
  •    P02730    Ser-162
• VSTPATTTSTFSR (13aa)
  •    Q8N3V7    Ser-165
• AGVSTNISTK (10aa)
  •    P52948-4    Thr-184
• IGDVSSSAVK (10aa)
  •    Q9BYJ9    Ser-196
• AGYSQGATQYTQAQQTR (17aa)
  •    Q96KR1    Ser-195
  •    Q96KR1    Thr-202
• IGGDLTAAVTK (11aa)
  •    Q7Z739    Thr-205
• SPVVSGDTSPR (11aa)
  •    P10636    Ser-208
• ESISVSSEQLAQFR (14aa)
  •    P00915    Ser-218
• IPPDSEATLVLVGR (14aa)
  •    P02730    Ser-224
• AVVPVSK (7aa)
  •    Q7Z589    Ser-228
• TITVPVSGSPK (11aa)
  •    Q7Z589    Ser-236
• TPTSGPVITK (10aa)
  •    Q6MZP7    Ser-238
• HLSNVSSTGSIDMVDSPQLATLADEVSASLAK (32aa)
  •    P10636    Ser-238
• AQPSVSLGAAYR (12aa)
  •    Q96PK6    Ser-244
• ILDSFAAAPVPTTTLVLK (18aa)
  •    P18583-1    Thr-253
  •    P18583-1    Thr-252
• LSQEDPDYGIR (11aa)
  •    P04040    Ser-254
• AQPSASLGVGYR (12aa)
  •    Q96PK6    Ser-256
  •    Q96PK6    Ser-254
• PSTQTTNTTTQK (12aa)
  •    Q7Z589    Thr-271
• VITSQAGK (8aa)
  •    Q14814    Ser-275
• AQPSVSLGAPYR (12aa)
  •    Q96PK6    Ser-280
• STAVTR (6aa)
  •    Q8NDX5    Thr-283
• ISEILLDHGAPIQAK (15aa)
  •    P16157    Ser-288
• STFRPRTSSNASTISGRLSP (20aa)
  •    Q12778    Thr-317
• TSSEASVSSSVAK (13aa)
  •    Q9NXV6    Thr-323
• SSSSTNTSLLTSK (13aa)
  •    Q9NXV6    Ser-349
• SSTNTSLLTS (10aa)
  •    Q9NXV6    Ser-349
• TTNYSTVPQK (10aa)
  •    Q6PJT7-2    Thr-369
• SSSQTSGSLVSK (12aa)
  •    Q9NXV6    Thr-379
• IVNVSLADLR (10aa)
  •    Q9HAU0    Ser-382
• SAVSTSVPTKPTENISK (17aa)
  •    Q5VT52    Ser-399
  •    Q5VT52    Thr-400
• GSPGTPGSRSRTPSL (15aa)
  •    P10636    Ser-400
• VVSTLPSTVLGK (12aa)
  •    Q9UKD1    Thr-404
• TPPKSPSSAKSRLQT (15aa)
  •    P10636    Ser-409/Ser-412/Ser-413
• QPSVTISSK (9aa)
  •    P12839    Thr-431
• PATAAVPTSQSVK (13aa)
  •    Q9UKY1    Ser-450
• STSQGSINSPVYSR (14aa)
  •    O14639    Ser-452
• TFDEIASGFR (10aa)
  •    P11166    Ser-465
• PVVSSAGTTSDK (12aa)
  •    P10636    Ser-489
• LTSTDTIPK (9aa)
  •    P11171    Ser-491
• VTGPQATGTPLVTMRPASQAGK (22aa)
  •    P51610    Thr-490
  •    P51610    Thr-495
• KWNNTGCQALPSQDEGPSKA (20aa)
  •    P01833    Asn-499
• LVTTPTGTQATYTRPTVSPSIGR (23aa)
  •    Q7Z589    Thr-501
  •    Q7Z589    Thr-506
• QVSQAQTTVQPSATLQR (17aa)
  •    O00268    Ser-528
• TTSGSIITVVPK (12aa)
  •    Q7Z589    Thr-534
  •    Q7Z589    Thr-535
• STEANVLPPSSIGFTFSVPVAK (22aa)
  •    P49790    Ser-534
  •    P49790    Ser-544
• AANIVIQTEPPVPVSINSNITR (22aa)
  •    Q9P2N5    Ser-546
• PHTSGMNRL (9aa)
  •    Q12778    Ser-550
• IISSNIVSGTTTK (13aa)
  •    Q7Z589    Ser-557
• IPPSSAPTVLSVPAGTTIVK (20aa)
  •    P51610    Ser-563
  •    P51610    Ser-562
• ALQTTGTAK (9aa)
  •    P52948-4    Thr-568
  •    P52948-4    Thr-567
• IPPSSAPTVLSVPAGTTIVKTMAVTPGTTTLPATVK (36aa)
  •    P51610    Ser-569
• TMAVTPGTTTLPATVK (16aa)
  •    P51610    Thr-579
• PSFPPSTSAVK (11aa)
  •    P35658    Thr-580
• SVGGSGGGSFGDNLVTR (17aa)
  •    P02545-3    Ser-582
• SISQSISGQK (10aa)
  •    Q8WXI9    Ser-584
• TSAVSSQANSQPPVQVSVK (19aa)
  •    Q9NYV4    Ser-597
  •    Q9NYV4    Thr-592
• ASASGSGAQVGGPISSGSSASSVTVTR (27aa)
  •    P02545-3    Thr-613
• TAAAQVGTSVSSATNTSTRPIITVHK (26aa)
  •    P51610    Ser-622
  •    P51610    Ser-620
  •    P51610    Thr-625
  •    P51610    Ser-623
• SGTVTVAQQAQVVTTVVGGVTK (22aa)
  •    P51610    Thr-652
  •    P51610    Thr-651
• FPHSVKTTTHSWVSG (15aa)
  •    Q12778    Ser-654
  •    Q12778    Thr-648
• STSTPTSPGPR (11aa)
  •    Q8WWM7    Ser-684
  •    Q8WWM7    Ser-678
• VMSVVQTKPVQTSAVTGQASTGPVTQIIQTK (31aa)
  •    P51610    Ser-685
• APPTLQAETATKPQATSAPSPAPK (24aa)
  •    Q96HA1    Thr-693
• PQATSAPSPAPK (12aa)
  •    Q96HA1    Ser-694
• PVQTSAVTGQASTGPVTQIIQTK (23aa)
  •    P51610    Thr-694
• GTVQTSVDTTK (11aa)
  •    Q96Q06    Ser-704
• LVTSADGK (8aa)
  •    P51610    Thr-726
• TPTSSPASSPLVAK (14aa)
  •    Q14684    Ser-731
• EQDQSFTALD (10aa)
  •    O14920    Ser-733
• PQTSGAYVLNK (11aa)
  •    Q9P2N5    Ser-738
• PIFTAPPKSEK (11aa)
  •    Q96HA1    Ser-738
• PTTIITTTQASGAGTK (16aa)
  •    P51610    Thr-739
• ASTPGAAAQIQEVK (14aa)
  •    P02730    Ser-745
• SGPSTVSEPAK (11aa)
  •    Q6P4R8    Thr-750
• PTILGISSVSPSTTKPGTTTIIK (23aa)
  •    P51610    Thr-760
• DLTSVLILQR (10aa)
  •    P11277    Ser-671
  •    P11277    Ser-767
• TIPMSAIITQAGATGVTSSPGIK (23aa)
  •    P51610    Thr-779
• SSVATTSGK (9aa)
  •    Q14157    Thr-782
  •    Q14157    Thr-783
• PLVtIPAPTSTK (12aa)
  •    Q70E73    Thr-784
• TAQTITSETPSSTTTTQITK (20aa)
  •    P11171    Ser-792
• VVTDETSFVLVSDK (14aa)
  •    P16157    Ser-794
• SPITIITTKVMTSGTGAPAK (20aa)
  •    P51610    Thr-801
• VMTSGTGAPAK (11aa)
  •    P51610    Ser-806
  •    P51610    Thr-808
• VPATATQTK (9aa)
  •    Q6P4R8    Thr-841
• VILENIASHEPR (12aa)
  •    P02549    Ser-844
• VPTTITLTLR (10aa)
  •    Q9P2N6    Thr-860
• LVTPVTVSAVKPAVTTLVVK (20aa)
  •    P51610    Thr-861
• TPTSQSYR (8aa)
  •    Q9Y2X9    Ser-891
• FGVSSSSSGPSQTLTSTGNFK (21aa)
  •    P49790    Ser-909
  •    P49790    Ser-908
• EGFSIPVSADGFK (13aa)
  •    Q7Z3J3    Ser-919
• LSTPPPLAEEEGLASR (16aa)
  •    P16157    Ser-960
• TGTTNTATTTVVANLGGHPQPTQVQFVCDRQE (32aa)
  •    P51610    Thr-1030
  •    P51610    Thr-1031
• SHLVHGSSPGVMGTSVAtsAs (21aa)
  •    P35658    Ser-1056
• SHLVHGSSPGVM-oxGTSVATSASK (25aa)
  •    P35658    Ser-1056
• QQEPVTSTSLVFGK (14aa)
  •    P49790    Thr-1112
• ITGGSSVPK (9aa)
  •    Q7Z589    Thr-1120
• RACAAGTPAVIR (12aa)
  •    P51610    Thr-1143
• ISVATGALEAAQGSK (15aa)
  •    P51610    Ser-1150
• STFSFSM-oxTKPSEK (16aa)
  •    P49790    Thr-1156
• DSGEGDTTSLR (11aa)
  •    P16157    Ser-1162
• ATFAFGAQTSTTADQGAAK (19aa)
  •    P49790    Thr-1180
  •    P49790    Thr-1179
• IETAVTSTPSASGQFSK (17aa)
  •    P35658    Thr-1201
• HSHAVSTAAMTR (12aa)
  •    P51610    Thr-1239
• LSESHPDATEDLQR (14aa)
  •    P02549    Ser-1250
• SLQGGSPSTTVTVTALE (17aa)
  •    P51610    Thr-1273
• LLTSQDVSYDEAR (13aa)
  •    P11277    Ser-1297
• TGTTHTATTATSNGGTGQPE (20aa)
  •    P51610    Thr-1335
• ASSTSLTSTQPTK (13aa)
  •    P35658    Ser-1354
• TSPENVQDRFALVTPK (16aa)
  •    P49792    Thr-1399
• TPVSYQNTMSR (11aa)
  •    O75376    Ser-1487
• IPGVSTPQTLAGTQK (15aa)
  •    Q8IWI9    Ser-1557
• AQGLLSAGHPEGEQIIR (17aa)
  •    P11277    Ser-1652
• GIASTSDPPTANIKPTPVVSTPSK (24aa)
  •    P12270    Ser-1676
• VSSQDYGR (8aa)
  •    P02549    Ser-1737
• LAGTVPSTVALLPSTATE (18aa)
  •    P51610    Thr-1743
• STVTTTTTTVTK (12aa)
  •    Q12830    Ser-1749
  •    Q12830    Thr-1753
• SAPASQASLR (10aa)
  •    Q14980    Ser-1844
• DVSSVELLMK (10aa)
  •    P11277    Ser-1936
• VM-oxVAPISGSVTTGTK (18aa)
  •    Q12830    Ser-2081
• MVLTTK (6aa)
  •    Q12830    Thr-2094
• VGSPATVTFQQNK (13aa)
  •    Q12830    Thr-2103
• IPAASAAAMNLASAR (15aa)
  •    Q9UQ35    Ser-2236
• RETIQQSSSLTSVPPTTFSLTFK (23aa)
  •    Q9Y520    Thr-2243
• AVAITQSPSSVR (12aa)
  •    P15822    Thr-2325
• ASDVDTSSSTLR (12aa)
  •    Q96T58    Thr-2529
  •    Q96T58    Ser-2530
• ATSTSPNSQSSK (12aa)
  •    Q9Y520    Thr-2693
• VNTSEGVVLLSYSGQK (16aa)
  •    Q96T58    Ser-2811
• ADRPSLEKPEPIHLSVSTPVTQGGTVK (27aa)
  •    Q96T58    Thr-2924
• GPQVSSALNLDTSK (14aa)
  •    Q09666    Ser-5603

GlcNAc(b

RES
1b:b-dglc-HEX-1:5
2s:n-acetyl
LIN
1:1d(2+1)2n