taxonomy (19)
protein (39)
source (22)
structure (1)
composition (1)
disease (3)
reference (41)
site (40)
peptide (3)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Mus musculus (House mouse)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Caenorhabditis elegans
- Autographa californica nucleopolyhedrovirus
- Trichinella spiralis
- Megathura crenulata (Californian giant keyhole limpet)
- Antheraea pernyi (Chinese oak silkmoth)
- Apis mellifera (Honeybee)
- Bombyx mori (Domestic silkworm)
- Drosophila melanogaster (Fruit fly)
- Drosophila melanogaster (Df(2R)achi2 mutant) (Fruit fly)
- Drosophila melanogaster (fdl mutant) (Fruit fly)
- Mamestra brassicae
- Spodoptera frugiperda (Fall armyworm)
- Human immunodeficiency virus (Hiv)
- Influenza a virus (strain a/fowl plague virus/rostock/34)
Taxonomy
- Adipocyte plasma membrane-associated protein / Homo sapiens Q9HDC9
- Alpha-n-acetylgalactosaminidase / Homo sapiens P17050
- Arylsulfatase a / Homo sapiens P15289
- Chymotrypsin-like elastase family member 3B / Homo sapiens P08861
- Haptoglobin / Homo sapiens P00738
- Interferon omega-1 / Homo sapiens P05000
- Interferon-gamma receptor alpha chain / Homo sapiens P15260
- Latent transforming growth factor beta binding protein 1 / Homo sapiens Q14766
- Myeloperoxidase / Homo sapiens P05164
- Plasminogen / Homo sapiens P00747
- Prorenin / Homo sapiens P00797
- Prosaposin / Homo sapiens P07602
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Serotransferrin / Homo sapiens P02787
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Lactotransferrin / Bos taurus P24627
- Immunoglobulin gamma-2a heavy chain / Mus musculus
- Interferon beta / Mus musculus P01575
- Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus P08101
- Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus P08289
- Mrc ox-45 surface antigen / Rattus norvegicus P10252
- Amiloride-sensitive amine oxidase / Sus scrofa Q9TRC7
- Major seminal plasma glycoprotein psp-ii / Sus scrofa P35496
- Uncharacterized protein from Crude Membrane Fraction / Caenorhabditis elegans
- Fg / Autographa californica nucleopolyhedrovirus
- Tsl-1 antigens / Trichinella spiralis
- Uncharacterized protein from Whole Organism / Trichinella spiralis
- Hemocyanin / Megathura crenulata Q10584 Q10583
- Arylphorin / Antheraea pernyi Q7Z1F8
- Uncharacterized protein from Hemolymph / Antheraea pernyi
- Hyaluronoglucosaminidase / Apis mellifera Q08169
- Phospholipase a2 / Apis mellifera P00630
- Membrane glycoproteins / Bombyx mori
- Uncharacterized protein from Undefined tissue / Drosophila melanogaster
- Membrane glycoproteins / Mamestra brassicae
- Interleukin-2 [mu33] / Spodoptera frugiperda P60568
- Membrane glycoproteins / Spodoptera frugiperda
- Surface protein gp120 / Human immunodeficiency virus
- Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34) P03459
Protein
- Embryo (UBERON_0000922)
- Hemolymph (UBERON_0001011)
- Kidney (UBERON_0002113) 6/9CII (CVCL_VT76)
- Kidney (UBERON_0002113) HEK293T (CVCL_0063)
- Kidney (UBERON_0002113)
- Liver (UBERON_0002107) AH130 (CVCL_4367)
- Liver (UBERON_0002107)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO-DG44 (CVCL_7180)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Ovary (UBERON_0000992) Sf9 (CVCL_0549)
- Pancreas (UBERON_0001264)
- Placenta (UBERON_0001987)
- Semen (UBERON_0001968)
- Seminal Fluid (UBERON_0006530)
- Spleen (UBERON_0002106)
- Venom (UBERON_0007113)
- BM-N (CVCL_Z633)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- SPC-Mb-92-C6 (CVCL_VT62)
Source
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
Reported structure
- Hex:3 HexNAc:2 dHex:1 (avg mass : 1056.9755 )
Composition
- Carcinoma, Hepatocellular (DOID:684)
- Gangliosidosis GM1 (DOID:3322)
- Gaucher Disease (DOID:1926)
Disease
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS (2014 - Chen R, Seebun D, Ye M, Zou H, Figeys D) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- The Drosophila fused lobes gene encodes an N-acetylglucosaminidase involved in N-glycan processing. (2006 - Renaud Léonard, Dubravko Rendic, Catherine Rabouille, Iain B H Wilson, Thomas Préat, Friedrich Altmann) / Status : Reviewed
- N-linked glycan structures of mouse interferon-beta produced by Bombyx mori larvae. (2003 - Misaki R, Nagaya H, Fujiyama K, Yanagihara I, Honda T, Seki T) / Status : Reviewed
- Structural determination of the N-glycans of a lepidopteran arylphorin reveals the presence of a monoglucosylated oligosaccharide in the storage protein. (2003 - Kim S, Hwang SK, Dwek RA, Rudd PM, Ahn YH, Kim EH, Cheong C, Kim SI, Park NS, Lee SM) / Status : Reviewed
- Structural analysis of N-linked glycans in Caenorhabditis elegans (2002 - Natsuka S, Adachi J, Kawaguchi M, Nakakita S, Hase S, Ichikawa A, Ikura K) / Status : Reviewed
- Hemocyanin from the keyhole limpet Megathura crenulata (KLH) carries a novel type of N-glycans with Gal(beta1-6)Man-motifs. (2002 - Kurokawa T, Wuhrer M, Lochnit G, Geyer H, Markl J, Geyer R) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- Characterization of the N-linked glycans of adult Trichinella spiralis. (2000 - Morelle W, Haslam S, Morris H, Dell A) / Status : Reviewed
- Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
- N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
- X-ray crystal structure and characterization of halide-binding sites of human myeloperoxidase at 1.8 A resolution. (2000 - Fiedler T, Davey C, Fenna R) / Status : Reviewed
- N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
- High-mannose-type oligosaccharides from human placental arylsulfatase A are core fucosylated as confirmed by MALDI MS. (2000 - Hoja-Lukowicz D, Cioczyk D, Bergquist J, Lityska A, Laidler P) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- N-glycan structures of a recombinant mouse soluble Fcgamma receptor II. (1998 - Takahashi N, Yamada W, Masuda K, Araki H, Tsukamoto Y, Galinha A, Sauts C, Kato K, Shimada I) / Status : Reviewed
- Structural characterization of the N-linked oligosaccharides derived from HIVgp120 expressed in lepidopteran cells. (1998 - Butters T, Yudkin B, Jacob G, Jones I) / Status : Reviewed
- Microheterogeneity of the oligosaccharides carried by the recombinant bovine lactoferrin expressed in Mamestra brassicae cells. (1997 - Lopez M, Coddeville B, Langridge J, Plancke Y, Sautire P, Chaabihi H, Chirat F, Harduin-Lepers A, Cerutti M, Verbert A, Delannoy P) / Status : Reviewed
- Fractionation and characterization of boar seminal plasma spermadhesion PSP-II glycoforms reveal the presence of uncommon N-acetylgalactosamine-containing N-linked oligosaccharides. (1997 - Solis D, Calvete J, Sanz L, Hettel C, Raida M, Diaz-Maurio T, Tpfer-Petersen E) / Status : Reviewed
- Differential N-glycan patterns of secreted and intracellular IgG produced in Trichoplusia ni cells. (1997 - Hsu T, Takahashi N, Tsukamoto Y, Kato K, Shimada I, Masuda K, Whiteley E, Fan J, Lee Y, Betenbaugh M) / Status : Reviewed
- Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
- The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
- Novel tyvelose-containing tri- and tetra-antennary N-glycans in the immunodominant antigens of the intracellular parasite Trichinella spiralis. (1994 - Reason A, Ellis L, Appleton J, Wisnewski N, Grieve R, McNeil M, Wassom D, Morris H, Dell A) / Status : Reviewed
- Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
- Structural analysis and localization of the carbohydrate moieties of a soluble human interferon gamma receptor produced in baculovirus-infected insect cells. (1994 - Manneberg M, Friedlein A, Kurth H, Lahm H, Fountoulakis M) / Status : Reviewed
- Glycosylation of recombinant prorenin in insect cells: the insect cell line Sf9 does not express the mannose 6-phosphate recognition signal. (1994 - Aeed P, Elhammer A) / Status : Reviewed
- Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Expression of human interferon omega 1 in Sf9 cells. No evidence for complex-type N-linked glycosylation or sialylation. (1993 - Voss T, Erglen E, Ahorn H, Kubelka V, Sugiyama K, Maurer-Fogy I, Glssl J) / Status : Reviewed
- Biosynthesis and secretion of human interleukin 2 glycoprotein variants from baculovirus-infected Sf21 cells. Characterization of polypeptides and posttranslational modifications. (1993 - Grabenhorst E, Hofer B, Nimtz M, Jger V, Conradt H) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Characterization of the oligosaccharide structures on bee venom phospholipase A2. (1993 - Hollander T, Aeed P, Elhammer A) / Status : Reviewed
- Alpha 1-6(alpha 1-3)-difucosylation of the asparagine-bound N-acetylglucosamine in honeybee venom phospholipase A2. (1992 - Staudacher E, Altmann F, Marz L, Hard K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Carbohydrate structure of human pancreatic elastase 1. (1991 - Wendorf P, Linder D, Sziegoleit A, Geyer R) / Status : Reviewed
- Characterization of oligosaccharide structures on a chimeric respiratory syncytial virus protein expressed in insect cell line Sf9. (1991 - Wathen M, Aeed P, Elhammer A) / Status : Reviewed
- Oligosaccharide structures present on asparagine-289 of recombinant human plasminogen expressed in a Chinese hamster ovary cell line. (1991 - Davidson D, Castellino F) / Status : Reviewed
- The oligosaccharides of influenza virus hemagglutinin expressed in insect cells by a baculovirus vector. (1990 - Kuroda K, Geyer H, Geyer R, Doerfler W, Klenk H) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
Reference
- Adipocyte plasma membrane-associated protein / Homo sapiens
-
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
-
Arylsulfatase a / Homo sapiens
- Undefined site
- Chymotrypsin-like elastase family member 3B / Homo sapiens
- Haptoglobin / Homo sapiens
- Interferon omega-1 / Homo sapiens
-
Interferon-gamma receptor alpha chain / Homo sapiens
- Undefined site
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- Myeloperoxidase / Homo sapiens
-
Plasminogen / Homo sapiens
- Undefined site
-
Prorenin / Homo sapiens
- Undefined site
-
Prosaposin / Homo sapiens
- Undefined site
- Prostate-specific antigen (psa-1) / Homo sapiens
-
Serotransferrin / Homo sapiens
- Undefined site
- Zinc-alpha-2-glycoprotein / Homo sapiens
- Lactotransferrin / Bos taurus
-
Immunoglobulin gamma-2a heavy chain / Mus musculus
- Undefined site
-
Interferon beta / Mus musculus
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus
- Undefined site
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
Amiloride-sensitive amine oxidase / Sus scrofa
- Undefined site
-
Major seminal plasma glycoprotein psp-ii / Sus scrofa
- Undefined site
-
Uncharacterized protein from Crude Membrane Fraction / Caenorhabditis elegans
- Undefined site
-
Fg / Autographa californica nucleopolyhedrovirus
- Undefined site
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
Uncharacterized protein from Whole Organism / Trichinella spiralis
- Undefined site
-
Hemocyanin / Megathura crenulata
- Undefined site
-
Arylphorin / Antheraea pernyi
- Undefined site
-
Uncharacterized protein from Hemolymph / Antheraea pernyi
- Undefined site
-
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
- Phospholipase a2 / Apis mellifera
-
Membrane glycoproteins / Bombyx mori
- Undefined site
-
Uncharacterized protein from Undefined tissue / Drosophila melanogaster
- Undefined site
-
Membrane glycoproteins / Mamestra brassicae
- Undefined site
-
Interleukin-2 [mu33] / Spodoptera frugiperda
- Undefined site
-
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
-
Surface protein gp120 / Human immunodeficiency virus
- Undefined site
-
Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)
- Undefined site
Reported glycosite
- KDIVEYYNDSNGSHVLQGRF (20aa)
- KNLFLNHSENATAKD (15aa)
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
Mass spectrometry observed peptide
-
- N-Linked / Pauci-Mannose
(avg mass : 1056.9755)
Detected as released in some experiments - Embryo (UBERON_0000922)
- Hemolymph (UBERON_0001011)
- Kidney (UBERON_0002113) 6/9CII (CVCL_VT76)
- Kidney (UBERON_0002113) HEK293T (CVCL_0063)
- Kidney (UBERON_0002113)
- Liver (UBERON_0002107) AH130 (CVCL_4367)
- Liver (UBERON_0002107)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO-DG44 (CVCL_7180)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Ovary (UBERON_0000992) Sf9 (CVCL_0549)
- Pancreas (UBERON_0001264)
- Placenta (UBERON_0001987)
- Semen (UBERON_0001968)
- Seminal Fluid (UBERON_0006530)
- Spleen (UBERON_0002106)
- Venom (UBERON_0007113)
- BM-N (CVCL_Z633)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- SPC-Mb-92-C6 (CVCL_VT62)
- Carcinoma, Hepatocellular (DOID:684)
- Gangliosidosis GM1 (DOID:3322)
- Gaucher Disease (DOID:1926)
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS (2014 - Chen R, Seebun D, Ye M, Zou H, Figeys D) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- The Drosophila fused lobes gene encodes an N-acetylglucosaminidase involved in N-glycan processing. (2006 - Renaud Léonard, Dubravko Rendic, Catherine Rabouille, Iain B H Wilson, Thomas Préat, Friedrich Altmann) / Status : Reviewed
- N-linked glycan structures of mouse interferon-beta produced by Bombyx mori larvae. (2003 - Misaki R, Nagaya H, Fujiyama K, Yanagihara I, Honda T, Seki T) / Status : Reviewed
- Structural determination of the N-glycans of a lepidopteran arylphorin reveals the presence of a monoglucosylated oligosaccharide in the storage protein. (2003 - Kim S, Hwang SK, Dwek RA, Rudd PM, Ahn YH, Kim EH, Cheong C, Kim SI, Park NS, Lee SM) / Status : Reviewed
- Structural analysis of N-linked glycans in Caenorhabditis elegans (2002 - Natsuka S, Adachi J, Kawaguchi M, Nakakita S, Hase S, Ichikawa A, Ikura K) / Status : Reviewed
- Hemocyanin from the keyhole limpet Megathura crenulata (KLH) carries a novel type of N-glycans with Gal(beta1-6)Man-motifs. (2002 - Kurokawa T, Wuhrer M, Lochnit G, Geyer H, Markl J, Geyer R) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- Characterization of the N-linked glycans of adult Trichinella spiralis. (2000 - Morelle W, Haslam S, Morris H, Dell A) / Status : Reviewed
- Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
- N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
- X-ray crystal structure and characterization of halide-binding sites of human myeloperoxidase at 1.8 A resolution. (2000 - Fiedler T, Davey C, Fenna R) / Status : Reviewed
- N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
- High-mannose-type oligosaccharides from human placental arylsulfatase A are core fucosylated as confirmed by MALDI MS. (2000 - Hoja-Lukowicz D, Cioczyk D, Bergquist J, Lityska A, Laidler P) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- N-glycan structures of a recombinant mouse soluble Fcgamma receptor II. (1998 - Takahashi N, Yamada W, Masuda K, Araki H, Tsukamoto Y, Galinha A, Sauts C, Kato K, Shimada I) / Status : Reviewed
- Structural characterization of the N-linked oligosaccharides derived from HIVgp120 expressed in lepidopteran cells. (1998 - Butters T, Yudkin B, Jacob G, Jones I) / Status : Reviewed
- Microheterogeneity of the oligosaccharides carried by the recombinant bovine lactoferrin expressed in Mamestra brassicae cells. (1997 - Lopez M, Coddeville B, Langridge J, Plancke Y, Sautire P, Chaabihi H, Chirat F, Harduin-Lepers A, Cerutti M, Verbert A, Delannoy P) / Status : Reviewed
- Fractionation and characterization of boar seminal plasma spermadhesion PSP-II glycoforms reveal the presence of uncommon N-acetylgalactosamine-containing N-linked oligosaccharides. (1997 - Solis D, Calvete J, Sanz L, Hettel C, Raida M, Diaz-Maurio T, Tpfer-Petersen E) / Status : Reviewed
- Differential N-glycan patterns of secreted and intracellular IgG produced in Trichoplusia ni cells. (1997 - Hsu T, Takahashi N, Tsukamoto Y, Kato K, Shimada I, Masuda K, Whiteley E, Fan J, Lee Y, Betenbaugh M) / Status : Reviewed
- Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
- The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
- Novel tyvelose-containing tri- and tetra-antennary N-glycans in the immunodominant antigens of the intracellular parasite Trichinella spiralis. (1994 - Reason A, Ellis L, Appleton J, Wisnewski N, Grieve R, McNeil M, Wassom D, Morris H, Dell A) / Status : Reviewed
- Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
- Structural analysis and localization of the carbohydrate moieties of a soluble human interferon gamma receptor produced in baculovirus-infected insect cells. (1994 - Manneberg M, Friedlein A, Kurth H, Lahm H, Fountoulakis M) / Status : Reviewed
- Glycosylation of recombinant prorenin in insect cells: the insect cell line Sf9 does not express the mannose 6-phosphate recognition signal. (1994 - Aeed P, Elhammer A) / Status : Reviewed
- Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Expression of human interferon omega 1 in Sf9 cells. No evidence for complex-type N-linked glycosylation or sialylation. (1993 - Voss T, Erglen E, Ahorn H, Kubelka V, Sugiyama K, Maurer-Fogy I, Glssl J) / Status : Reviewed
- Biosynthesis and secretion of human interleukin 2 glycoprotein variants from baculovirus-infected Sf21 cells. Characterization of polypeptides and posttranslational modifications. (1993 - Grabenhorst E, Hofer B, Nimtz M, Jger V, Conradt H) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Characterization of the oligosaccharide structures on bee venom phospholipase A2. (1993 - Hollander T, Aeed P, Elhammer A) / Status : Reviewed
- Alpha 1-6(alpha 1-3)-difucosylation of the asparagine-bound N-acetylglucosamine in honeybee venom phospholipase A2. (1992 - Staudacher E, Altmann F, Marz L, Hard K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Carbohydrate structure of human pancreatic elastase 1. (1991 - Wendorf P, Linder D, Sziegoleit A, Geyer R) / Status : Reviewed
- Characterization of oligosaccharide structures on a chimeric respiratory syncytial virus protein expressed in insect cell line Sf9. (1991 - Wathen M, Aeed P, Elhammer A) / Status : Reviewed
- Oligosaccharide structures present on asparagine-289 of recombinant human plasminogen expressed in a Chinese hamster ovary cell line. (1991 - Davidson D, Castellino F) / Status : Reviewed
- The oligosaccharides of influenza virus hemagglutinin expressed in insect cells by a baculovirus vector. (1990 - Kuroda K, Geyer H, Geyer R, Doerfler W, Klenk H) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- Adipocyte plasma membrane-associated protein / Homo sapiens
-
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
-
Arylsulfatase a / Homo sapiens
- Undefined site
- Chymotrypsin-like elastase family member 3B / Homo sapiens
- Haptoglobin / Homo sapiens
- Interferon omega-1 / Homo sapiens
-
Interferon-gamma receptor alpha chain / Homo sapiens
- Undefined site
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- Myeloperoxidase / Homo sapiens
-
Plasminogen / Homo sapiens
- Undefined site
-
Prorenin / Homo sapiens
- Undefined site
-
Prosaposin / Homo sapiens
- Undefined site
- Prostate-specific antigen (psa-1) / Homo sapiens
-
Serotransferrin / Homo sapiens
- Undefined site
- Zinc-alpha-2-glycoprotein / Homo sapiens
- Lactotransferrin / Bos taurus
-
Immunoglobulin gamma-2a heavy chain / Mus musculus
- Undefined site
-
Interferon beta / Mus musculus
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus
- Undefined site
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
Amiloride-sensitive amine oxidase / Sus scrofa
- Undefined site
-
Major seminal plasma glycoprotein psp-ii / Sus scrofa
- Undefined site
-
Uncharacterized protein from Crude Membrane Fraction / Caenorhabditis elegans
- Undefined site
-
Fg / Autographa californica nucleopolyhedrovirus
- Undefined site
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
Uncharacterized protein from Whole Organism / Trichinella spiralis
- Undefined site
-
Hemocyanin / Megathura crenulata
- Undefined site
-
Arylphorin / Antheraea pernyi
- Undefined site
-
Uncharacterized protein from Hemolymph / Antheraea pernyi
- Undefined site
-
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
- Phospholipase a2 / Apis mellifera
-
Membrane glycoproteins / Bombyx mori
- Undefined site
-
Uncharacterized protein from Undefined tissue / Drosophila melanogaster
- Undefined site
-
Membrane glycoproteins / Mamestra brassicae
- Undefined site
-
Interleukin-2 [mu33] / Spodoptera frugiperda
- Undefined site
-
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
-
Surface protein gp120 / Human immunodeficiency virus
- Undefined site
-
Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)
- Undefined site
- KDIVEYYNDSNGSHVLQGRF (20aa)
- KNLFLNHSENATAKD (15aa)
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Pauci-Mannose
(avg mass : 1056.9755)
