GlyConnect

taxonomy (17) protein (37) source (20) structure (1) composition (1) disease (3) reference (38) site (38) peptide (1)

Taxonomy

Protein

Source

Reported structure

N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc

Composition

Hex:3 HexNAc:2 dHex:1 (avg mass : 1056.9755 )

Disease

Reference

Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS (2014 - Chen R, Seebun D, Ye M, Zou H, Figeys D) / Status : Reviewed
Structural determination of the N-glycans of a lepidopteran arylphorin reveals the presence of a monoglucosylated oligosaccharide in the storage protein. (2003 - Kim S, Hwang SK, Dwek RA, Rudd PM, Ahn YH, Kim EH, Cheong C, Kim SI, Park NS, Lee SM) / Status : Reviewed
N-linked glycan structures of mouse interferon-beta produced by Bombyx mori larvae. (2003 - Misaki R, Nagaya H, Fujiyama K, Yanagihara I, Honda T, Seki T) / Status : Reviewed
Hemocyanin from the keyhole limpet Megathura crenulata (KLH) carries a novel type of N-glycans with Gal(beta1-6)Man-motifs. (2002 - Kurokawa T, Wuhrer M, Lochnit G, Geyer H, Markl J, Geyer R) / Status : Reviewed
Structural analysis of N-linked glycans in Caenorhabditis elegans (2002 - Natsuka S, Adachi J, Kawaguchi M, Nakakita S, Hase S, Ichikawa A, Ikura K) / Status : Reviewed
Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
High-mannose-type oligosaccharides from human placental arylsulfatase A are core fucosylated as confirmed by MALDI MS. (2000 - Hoja-Lukowicz D, Cioczyk D, Bergquist J, Lityska A, Laidler P) / Status : Reviewed
Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
X-ray crystal structure and characterization of halide-binding sites of human myeloperoxidase at 1.8 A resolution. (2000 - Fiedler T, Davey C, Fenna R) / Status : Reviewed
N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
Characterization of the N-linked glycans of adult Trichinella spiralis. (2000 - Morelle W, Haslam S, Morris H, Dell A) / Status : Reviewed
Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
Structural characterization of the N-linked oligosaccharides derived from HIVgp120 expressed in lepidopteran cells. (1998 - Butters T, Yudkin B, Jacob G, Jones I) / Status : Reviewed
N-glycan structures of a recombinant mouse soluble Fcgamma receptor II. (1998 - Takahashi N, Yamada W, Masuda K, Araki H, Tsukamoto Y, Galinha A, Sauts C, Kato K, Shimada I) / Status : Reviewed
Differential N-glycan patterns of secreted and intracellular IgG produced in Trichoplusia ni cells. (1997 - Hsu T, Takahashi N, Tsukamoto Y, Kato K, Shimada I, Masuda K, Whiteley E, Fan J, Lee Y, Betenbaugh M) / Status : Reviewed
Microheterogeneity of the oligosaccharides carried by the recombinant bovine lactoferrin expressed in Mamestra brassicae cells. (1997 - Lopez M, Coddeville B, Langridge J, Plancke Y, Sautire P, Chaabihi H, Chirat F, Harduin-Lepers A, Cerutti M, Verbert A, Delannoy P) / Status : Reviewed
Fractionation and characterization of boar seminal plasma spermadhesion PSP-II glycoforms reveal the presence of uncommon N-acetylgalactosamine-containing N-linked oligosaccharides. (1997 - Solis D, Calvete J, Sanz L, Hettel C, Raida M, Diaz-Maurio T, Tpfer-Petersen E) / Status : Reviewed
Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
Structural analysis and localization of the carbohydrate moieties of a soluble human interferon gamma receptor produced in baculovirus-infected insect cells. (1994 - Manneberg M, Friedlein A, Kurth H, Lahm H, Fountoulakis M) / Status : Reviewed
Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
Glycosylation of recombinant prorenin in insect cells: the insect cell line Sf9 does not express the mannose 6-phosphate recognition signal. (1994 - Aeed P, Elhammer A) / Status : Reviewed
Novel tyvelose-containing tri- and tetra-antennary N-glycans in the immunodominant antigens of the intracellular parasite Trichinella spiralis. (1994 - Reason A, Ellis L, Appleton J, Wisnewski N, Grieve R, McNeil M, Wassom D, Morris H, Dell A) / Status : Reviewed
Expression of human interferon omega 1 in Sf9 cells. No evidence for complex-type N-linked glycosylation or sialylation. (1993 - Voss T, Erglen E, Ahorn H, Kubelka V, Sugiyama K, Maurer-Fogy I, Glssl J) / Status : Reviewed
Biosynthesis and secretion of human interleukin 2 glycoprotein variants from baculovirus-infected Sf21 cells. Characterization of polypeptides and posttranslational modifications. (1993 - Grabenhorst E, Hofer B, Nimtz M, Jger V, Conradt H) / Status : Reviewed
Characterization of the oligosaccharide structures on bee venom phospholipase A2. (1993 - Hollander T, Aeed P, Elhammer A) / Status : Reviewed
Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
Alpha 1-6(alpha 1-3)-difucosylation of the asparagine-bound N-acetylglucosamine in honeybee venom phospholipase A2. (1992 - Staudacher E, Altmann F, Marz L, Hard K, Kamerling J, Vliegenthart J) / Status : Reviewed
Carbohydrate structure of human pancreatic elastase 1. (1991 - Wendorf P, Linder D, Sziegoleit A, Geyer R) / Status : Reviewed
Characterization of oligosaccharide structures on a chimeric respiratory syncytial virus protein expressed in insect cell line Sf9. (1991 - Wathen M, Aeed P, Elhammer A) / Status : Reviewed
Oligosaccharide structures present on asparagine-289 of recombinant human plasminogen expressed in a Chinese hamster ovary cell line. (1991 - Davidson D, Castellino F) / Status : Reviewed
The oligosaccharides of influenza virus hemagglutinin expressed in insect cells by a baculovirus vector. (1990 - Kuroda K, Geyer H, Geyer R, Doerfler W, Klenk H) / Status : Reviewed
Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed

Reported glycosite

Adipocyte plasma membrane-associated protein / Homo sapiens
- Asn-160
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
Arylsulfatase a / Homo sapiens
- Undefined site
Chymotrypsin-like elastase family member 3B / Homo sapiens
- Asn-114
Interferon omega-1 / Homo sapiens
- Asn-101
Interferon-gamma receptor alpha chain / Homo sapiens
- Undefined site
Latent transforming growth factor beta binding protein 1 / Homo sapiens
- Asn-1366
Myeloperoxidase / Homo sapiens
- Asn-483
Prorenin / Homo sapiens
- Undefined site
Prosaposin / Homo sapiens
- Undefined site
Prostate-specific antigen (psa-1) / Homo sapiens
- Asn-69
Recombinant plasminogen - [r580s] / Homo sapiens
- Undefined site
Serotransferrin / Homo sapiens
- Undefined site
Lactotransferrin / Bos taurus
- Asn-252
- Asn-495
Immunoglobulin gamma-2a heavy chain / Mus musculus
- Undefined site
Interferon beta / Mus musculus
- Undefined site
Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus
- Undefined site
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
Amiloride-sensitive amine oxidase / Sus scrofa
- Undefined site
Major seminal plasma glycoprotein psp-ii / Sus scrofa
- Undefined site
Uncharacterized protein from Crude Membrane Fraction / Caenorhabditis elegans
- Undefined site
Fg / Autographa californica nucleopolyhedrovirus
- Undefined site
Tsl-1 antigens / Trichinella spiralis
- Undefined site
Uncharacterized protein from Whole Organism / Trichinella spiralis
- Undefined site
Hemocyanin / Megathura crenulata
- Undefined site
Arylphorin / Antheraea pernyi
- Undefined site
Uncharacterized protein from Hemolymph / Antheraea pernyi
- Undefined site
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
Phospholipase a2 / Apis mellifera
- Asn-46
Membrane glycoproteins / Bombyx mori
- Undefined site
Uncharacterized protein from Undefined tissue / Drosophila melanogaster
- Undefined site
Membrane glycoproteins / Mamestra brassicae
- Undefined site
Interleukin-2 [mu33] / Spodoptera frugiperda
- Undefined site
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
Gp120 / Human immunodeficiency virus
- Undefined site
Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)
- Undefined site

Mass spectrometry observed peptide

CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
- Q14766 Asn-1366

- N-Linked / Pauci-Mannose (avg mass : 1056.9755)

Cross-references

GlyTouCan : G82348BZ

UniCarb-DB :

Composition

Hex:3 HexNAc:2 dHex:1

IUPAC

Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc

GlycoCT

RES
1b:b-dglc-HEX-1:5
2s:n-acetyl
3b:b-dglc-HEX-1:5
4s:n-acetyl
5b:b-dman-HEX-1:5
6b:a-dman-HEX-1:5
7b:a-dman-HEX-1:5
8b:a-lgal-HEX-1:5|6:d
LIN
1:1d(2+1)2n
2:1o(4+1)3d
3:3d(2+1)4n
4:3o(4+1)5d
5:5o(3+1)6d
6:5o(6+1)7d
7:1o(6+1)8d