taxonomy (2)
protein (19)
source (7)
structure (1)
composition (1)
disease (3)
reference (10)
site (28)
peptide (24)
- Attractin / Homo sapiens O75882
- Complement c3 / Homo sapiens P01024
- Galectin-3-binding protein / Homo sapiens Q08380
- Immunoglobulin alpha (non secretory) / Homo sapiens P01877 P01876
- Immunoglobulin epsilon chain c region / Homo sapiens P01854
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant delta / Homo sapiens P01880
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens Q14624
- Lactoperoxidase / Homo sapiens P22079
- Lactotransferrin / Homo sapiens P02788
- Monocyte differentiation antigen cd14 / Homo sapiens P08571
- Myeloperoxidase / Homo sapiens P05164
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Pro-epidermal growth factor / Homo sapiens P01133
- Tenascin / Homo sapiens P24821
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Blood Serum (UBERON_0001977)
- Colostrum (UBERON_0001914)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Milk (UBERON_0001913)
- BTI-Tn-5B1-4 (CVCL_C190)
- HEK293 (CVCL_0045)
- HEK293T (CVCL_0063)
Source
- N-Linked / High-Mannose / Structure 314
Reported structure
- Hex:7 HexNAc:2 (avg mass : 1559.4021 )
Composition
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- A Microarray-Matrix-assisted Laser Desorption/Ionization-Mass Spectrometry Approach for Site-specific Protein N-glycosylation Analysis, as Demonstrated for Human Serum Immunoglobulin M (IgM) (2015 - Martin Pabst, Simon Karl Küster, Fabian Wahl, Jasmin Krismer, Petra S.Dittrich, Renato Zenobi) / Status : Reviewed
- A Method for Comprehensive Glycosite-Mapping and Direct Quantitation of Serum Glycoproteins (2015 - Qiuting Hong, L. Renee Ruhaak, Carol Stroble, Evan Parker, Jincui Huang, Emanual Maverakis, Carlito B. Lebrilla) / Status : Reviewed
- A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
- Expression and glycoengineering of functionally active heteromultimeric IgM in plants (2014 - Loos A, Gruber C, Altmann F, Mehofer U, Hensel F, Grandits M, Oostenbrink C, Stadlmayr G, Furtmüller PG, Steinkellner H) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- GlycoSpectrumScan: Fishing Glycopeptides from MS Spectra of Protease Digests of Human Colostrum sIgA (2010 - Nandan Deshpande, Pia H. Jensen, Nicolle H. Packer, Daniel Kolarich) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
Reference
- Attractin / Homo sapiens
- Complement c3 / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Immunoglobulin alpha (non secretory) / Homo sapiens
-
Immunoglobulin epsilon chain c region / Homo sapiens
- Undefined site
- Asn-275
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant mu / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Lactoperoxidase / Homo sapiens
- Lactotransferrin / Homo sapiens
- Monocyte differentiation antigen cd14 / Homo sapiens
- Myeloperoxidase / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Pro-epidermal growth factor / Homo sapiens
- Tenascin / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- KTVLTPATNHMGNVTFTIPANRE (23aa)
- KTVLTPATNHMGNVTFTIPANREFKS (26aa)
- RVFLNGSRQERV (12aa)
- TQSLLIVNNATNVVIK (16aa)
- KDIVEYYNDSNGSHVLQGRFGCEIENNRS (29aa)
- RLSLHRPALEDLLLGSEANLTCTLTGLRD (29aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- RLRNVSWATGRS (12aa)
- SHPNATFSAVGE (12aa)
- RLRNLSSPLGLMAVNQEVSDHGLPYLPYDSKK (32aa)
- RNLSSPLGLMAVNQEVSDHGLPYLPYDSKK (30aa)
- RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
- VFNATR (6aa)
- RNMSNQLGLLAVNQRF (16aa)
- RVFHIHNESWVLLTPKA (17aa)
- STGKPTLYNVSLV(MSO)SDTAGTCY (26aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- KYWCKWNNTGCQALPSQDEGPSKA (24aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
- KAAIPSALDTNSSKS (15aa)
- DFGGFNFSQILPDPSKPSK (19aa)
- RLNYSLPTGQWVGVQLPRN (19aa)
- NFTTAPAICHDGK (13aa)
- GVFVSNGTHWFVTQR (15aa)
Mass spectrometry observed peptide
-
- N-Linked / High-Mannose
(avg mass : 1559.4021)
- Blood Serum (UBERON_0001977)
- Colostrum (UBERON_0001914)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Milk (UBERON_0001913)
- BTI-Tn-5B1-4 (CVCL_C190)
- HEK293 (CVCL_0045)
- HEK293T (CVCL_0063)
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- A Microarray-Matrix-assisted Laser Desorption/Ionization-Mass Spectrometry Approach for Site-specific Protein N-glycosylation Analysis, as Demonstrated for Human Serum Immunoglobulin M (IgM) (2015 - Martin Pabst, Simon Karl Küster, Fabian Wahl, Jasmin Krismer, Petra S.Dittrich, Renato Zenobi) / Status : Reviewed
- A Method for Comprehensive Glycosite-Mapping and Direct Quantitation of Serum Glycoproteins (2015 - Qiuting Hong, L. Renee Ruhaak, Carol Stroble, Evan Parker, Jincui Huang, Emanual Maverakis, Carlito B. Lebrilla) / Status : Reviewed
- A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
- Expression and glycoengineering of functionally active heteromultimeric IgM in plants (2014 - Loos A, Gruber C, Altmann F, Mehofer U, Hensel F, Grandits M, Oostenbrink C, Stadlmayr G, Furtmüller PG, Steinkellner H) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- GlycoSpectrumScan: Fishing Glycopeptides from MS Spectra of Protease Digests of Human Colostrum sIgA (2010 - Nandan Deshpande, Pia H. Jensen, Nicolle H. Packer, Daniel Kolarich) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
- Attractin / Homo sapiens
- Complement c3 / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Immunoglobulin alpha (non secretory) / Homo sapiens
-
Immunoglobulin epsilon chain c region / Homo sapiens
- Undefined site
- Asn-275
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant mu / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Lactoperoxidase / Homo sapiens
- Lactotransferrin / Homo sapiens
- Monocyte differentiation antigen cd14 / Homo sapiens
- Myeloperoxidase / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Pro-epidermal growth factor / Homo sapiens
- Tenascin / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- KTVLTPATNHMGNVTFTIPANRE (23aa)
- KTVLTPATNHMGNVTFTIPANREFKS (26aa)
- RVFLNGSRQERV (12aa)
- TQSLLIVNNATNVVIK (16aa)
- KDIVEYYNDSNGSHVLQGRFGCEIENNRS (29aa)
- RLSLHRPALEDLLLGSEANLTCTLTGLRD (29aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- RLRNVSWATGRS (12aa)
- SHPNATFSAVGE (12aa)
- RLRNLSSPLGLMAVNQEVSDHGLPYLPYDSKK (32aa)
- RNLSSPLGLMAVNQEVSDHGLPYLPYDSKK (30aa)
- RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
- VFNATR (6aa)
- RNMSNQLGLLAVNQRF (16aa)
- RVFHIHNESWVLLTPKA (17aa)
- STGKPTLYNVSLV(MSO)SDTAGTCY (26aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- KYWCKWNNTGCQALPSQDEGPSKA (24aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
- KAAIPSALDTNSSKS (15aa)
- DFGGFNFSQILPDPSKPSK (19aa)
- RLNYSLPTGQWVGVQLPRN (19aa)
- NFTTAPAICHDGK (13aa)
- GVFVSNGTHWFVTQR (15aa)
Source
Reference
Reported glycosite
Mass spectrometry observed peptide
3D structure from GLYCAM
- N-Linked / High-Mannose
(avg mass : 1559.4021)