taxonomy (2)
protein (50)
source (9)
structure (1)
composition (1)
disease (11)
reference (24)
site (87)
peptide (76)
- ADAM DEC1 / Homo sapiens O15204
- Alpha-1-antichymotrypsin / Homo sapiens P01011
- Alpha-S1-casein / Homo sapiens P47710
- Angiopoietin-related protein 4 / Homo sapiens Q9BY76
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Angiotensinogen / Homo sapiens P01019
- Butyrophilin subfamily 1 member A1 / Homo sapiens Q13410
- Carbonic anhydrase 6 / Homo sapiens P23280
- Chordin-like protein 2 / Homo sapiens Q6WN34
- Clusterin / Homo sapiens P10909
- Coagulation factor XI / Homo sapiens P03951
- Desmocollin-2 / Homo sapiens Q02487
- Fibronectin / Homo sapiens P02751
- Galectin-3-binding protein / Homo sapiens Q08380
- Haptoglobin / Homo sapiens P00738
- Immunoglobulin alpha (non secretory) / Homo sapiens P01877 P01876
- Immunoglobulin epsilon chain c region / Homo sapiens P01854
- Immunoglobulin gamma / Homo sapiens P01857 P01860 P01859 P01861
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant delta / Homo sapiens P01880
- Immunoglobulin heavy constant gamma 1 / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 3 / Homo sapiens P01860
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Immunoglobulin J chain / Homo sapiens P01591
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens Q14624
- Lactadherin / Homo sapiens Q08431
- Lactotransferrin / Homo sapiens P02788
- Leucine-rich alpha-2-glycoprotein / Homo sapiens P02750
- Lipoprotein lipase / Homo sapiens P06858
- Macrophage mannose receptor 1 / Homo sapiens P22897
- Metalloproteinase inhibitor 1 / Homo sapiens P01033
- Monocyte differentiation antigen cd14 / Homo sapiens P08571
- N-acetylglucosamine-1-phosphotransferase subunit gamma / Homo sapiens Q9UJJ9
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Recombinant Mucin-1 Muc1f/4tr / Homo sapiens P15941 Q99102
- Sclerostin domain-containing protein 1 / Homo sapiens Q6X4U4
- Serotransferrin / Homo sapiens P02787
- Sialic acid-binding Ig-like lectin 5 / Homo sapiens O15389
- Sialic acid-binding Ig-like lectin 7 / Homo sapiens Q9Y286
- Sialic acid-binding Ig-like lectin 8 / Homo sapiens Q9NYZ4
- Sulfhydryl oxidase 1 / Homo sapiens O00391
- Tenascin / Homo sapiens P24821
- Tumor necrosis factor ligand superfamily member 13 / Homo sapiens O75888
- Tumor necrosis factor receptor superfamily member 11B / Homo sapiens O00300
- Vitronectin / Homo sapiens P04004
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Colostrum (UBERON_0001914)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO E1a (CVCL_VU65)
- CHO (CVCL_0213)
- HEK293 (CVCL_0045)
- HEK293T (CVCL_0063)
Source
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
Reported structure
- Hex:5 HexNAc:4 dHex:1 (avg mass : 1787.6503 )
Composition
- Asymptomatic myositis (DOID:633)
- Atopic dermatitis (DOID:3310)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Hyper IgE syndrome (DOID:0080545)
- Hyperimmune condition
- Hypersensitivity reaction disease (DOID:0060056)
- IgE myeloma (DOID:9538)
- Myeloma, Multiple (DOID:9538)
- Myositis (DOID:633)
- Systemic lupus erythematosus (DOID:9074)
Disease
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- A Microarray-Matrix-assisted Laser Desorption/Ionization-Mass Spectrometry Approach for Site-specific Protein N-glycosylation Analysis, as Demonstrated for Human Serum Immunoglobulin M (IgM) (2015 - Martin Pabst, Simon Karl Küster, Fabian Wahl, Jasmin Krismer, Petra S.Dittrich, Renato Zenobi) / Status : Reviewed
- A Method for Comprehensive Glycosite-Mapping and Direct Quantitation of Serum Glycoproteins (2015 - Qiuting Hong, L. Renee Ruhaak, Carol Stroble, Evan Parker, Jincui Huang, Emanual Maverakis, Carlito B. Lebrilla) / Status : Reviewed
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
- In-depth analysis of site-specific N-glycosylation in vitronectin from human plasma by tandem mass spectrometry with immunoprecipitation (2014 - Hwang H, Lee JY, Lee HK, Park GW, Jeong HK, Moon MH, Kim JY, Yoo JS.) / Status : Reviewed
- Glycomic analysis of high density lipoprotein shows a highly sialylated particle (2014 - Huang J1, Lee H, Zivkovic AM, Smilowitz JT, Rivera N, German JB, Lebrilla CB) / Status : Reviewed
- Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
- Immunoglobulin G (IgG) Fab Glycosylation Analysis Using a New Mass Spectrometric High-throughput Profiling Method Reveals Pregnancy-associated Changes (2014 - Albert Bondt, Yoann Rombouts, Maurice H.J.Selman, Paul J.Hensbergen, Karli R.Reiding, Johanna M.W.Hazes, Radboud J.E.M.Dolhain, Manfred Wuhrer) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Hypomorphic homozygous mutations in phosphoglucomutase 3 (PGM3) impair immunity and increase serum IgE levels, (2014 - Atfa Sassi, Sandra Lazaroski, Gang Wu, Stuart M. Haslam, Manfred Fliegauf, Fethi Mellouli, Turkan Patiroglu, Ekrem Unal, Mehmet Akif Ozdemir, Zineb Jouhadi, Khadija Khadir, Leila Ben-Khemis, Meriem Ben-Ali, Imen Ben-Mustapha, Lamia Borchani, Dietmar Pfeifer, Thilo Jakob, Monia Khemiri, A. Charlotta Asplund, Manuela O. Gustafsson, Karin E. Lundin, Elin Falk-Sörqvist, Lotte N. Moens, Hatice Eke Gungor, Karin R. Engelhardt, Magdalena Dziadzio, Hans Stauss, Bernhard Fleckenstein, Rebecca Meier, Khairunnadiya Prayitno, Andrea Maul-Pavicic, Sandra Schaffer, Mirzokhid Rakhmanov, Philipp Henneke, Helene Kraus, Hermann Eibel, Uwe Kölsch, Sellama Nadifi, Mats Nilsson, Mohamed Bejaoui, Alejandro A. Schäffer, C.I. Edvard Smith, Anne Dell, Mohamed-Ridha Barbouche, Bodo Grimbacher) / Status : Reviewed
- Site-specific N-glycosylation analysis of human factor XI: Identification of a noncanonical NXC glycosite (2014 - Faid V, Denguir N, Chapuis V, Bihoreau N, Chevreux G) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- Absolute Quantitation of Immunoglobulin G and Its Glycoforms Using Multiple Reaction Monitoring (2013 - Qiuting Hong, Carlito B. Lebrilla, Suzanne Miyamoto, L. Renee Ruhaak) / Status : Reviewed
- Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
- Mass Spectrometric Determination of IgG Subclass-Specific Glycosylation Profiles in Siblings Discordant for Myositis Syndromes (2011 - Irina Perdivara, Shyamal D. Peddada, Frederick W. Miller, Kenneth B. Tomer, Leesa J. Deterding) / Status : Reviewed
- GlycoSpectrumScan: Fishing Glycopeptides from MS Spectra of Protease Digests of Human Colostrum sIgA (2010 - Nandan Deshpande, Pia H. Jensen, Nicolle H. Packer, Daniel Kolarich) / Status : Reviewed
- Differential Glycosylation of Polymeric and Monomeric IgA: A Possible Role in Glomerular Inflammation in IgA Nephropathy (2006 - Beatrijs D. Oortwijn, Anja Roos, Louise Royle, Daniëlle J. van Gijlswijk-Janssen, Maria C. Faber-Krol, Jan-Willem Eijgenraam, Raymond A. Dwek, Mohamed R. Daha, Pauline M. Rudd, Cees van Kooten) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
- A comparative study of the asparagine-linked oligosaccharides on siglec-5, siglec-7 and siglec-8, expressed in a CHO cell line, and their contribution to ligand recognition (2001 - Freeman, Birrell, D Alessio, Erickson-Miller, Kikly, Camilleri) / Status : Reviewed
Reference
- ADAM DEC1 / Homo sapiens
- Alpha-1-antichymotrypsin / Homo sapiens
- Alpha-S1-casein / Homo sapiens
- Angiopoietin-related protein 4 / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Angiotensinogen / Homo sapiens
- Butyrophilin subfamily 1 member A1 / Homo sapiens
- Carbonic anhydrase 6 / Homo sapiens
- Chordin-like protein 2 / Homo sapiens
- Clusterin / Homo sapiens
- Coagulation factor XI / Homo sapiens
- Desmocollin-2 / Homo sapiens
- Fibronectin / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Haptoglobin / Homo sapiens
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
- Immunoglobulin epsilon chain c region / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Lactadherin / Homo sapiens
- Lactotransferrin / Homo sapiens
- Leucine-rich alpha-2-glycoprotein / Homo sapiens
- Lipoprotein lipase / Homo sapiens
- Macrophage mannose receptor 1 / Homo sapiens
- Metalloproteinase inhibitor 1 / Homo sapiens
- Monocyte differentiation antigen cd14 / Homo sapiens
- N-acetylglucosamine-1-phosphotransferase subunit gamma / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Recombinant Mucin-1 Muc1f/4tr / Homo sapiens
- Sclerostin domain-containing protein 1 / Homo sapiens
- Serotransferrin / Homo sapiens
-
Sialic acid-binding Ig-like lectin 5 / Homo sapiens
- Undefined site
-
Sialic acid-binding Ig-like lectin 7 / Homo sapiens
- Undefined site
-
Sialic acid-binding Ig-like lectin 8 / Homo sapiens
- Undefined site
- Sulfhydryl oxidase 1 / Homo sapiens
- Tenascin / Homo sapiens
- Tumor necrosis factor ligand superfamily member 13 / Homo sapiens
- Tumor necrosis factor receptor superfamily member 11B / Homo sapiens
- Vitronectin / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- KNVTLHVPSKLDAEKL (16aa)
- KNVTLHVPSKL (11aa)
- YKNNSDISSTR (11aa)
- NNSDISSTR (9aa)
- KNDATEILYSHVVKPVPAHPSSNSTLNQARN (31aa)
- RLSPNASAEHLELRW (15aa)
- KQTDEIKDTRNESTQNCVVAEPEKM (25aa)
- KDTRNESTQNCVVAEPEKMESSISSSSEEMSLSKC (35aa)
- KDTRNESTQNCVVAEPEKM (19aa)
- RNESTQNCVVAEPEKM (16aa)
- RTPEDTAEDTCHLIPGVAESVATCHFNHSSKT (32aa)
- ENISDPTSPLR (11aa)
- RIIVPLNNRENISDPTSPLRT (21aa)
- RENISDPTSPLRT (13aa)
- RIIVPLNNRENISDPTSPLRTRF (23aa)
- KKKEDALNETRE (12aa)
- KKKEDALNETRESETKL (17aa)
- KYEFCPFHNVTQHEQTFRW (19aa)
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- RSHNRSEEFLIAGKL (15aa)
- KNDTLLGIKG (10aa)
- KWECKNDTLLGIKG (14aa)
- KDIVEYYNDSNGSHVLQGRF (20aa)
- KSCQHNGTMYQHGEIFSAHELFPSRL (26aa)
- TQSLLIVNNATNVVIK (16aa)
- KQHSVLHLVPINATSKD (17aa)
- RTLNQSSDELQLSMGNAMFVKE (22aa)
- KNGSGAVFPVAGADVQTLRE (20aa)
- RNVSWATGRS (10aa)
- RTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (32aa)
- RRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (33aa)
- VYSSANNCTFE (11aa)
- REEQFNSTFRV (11aa)
- EEQFNSTFR (9aa)
- VAR_003892 226:Y→F
- P01859 Asn-176     Immunoglobulin heavy constant gamma 2 / Homo sapiens
- VAR_003892 226:Y→F
- VAR_003892 226:Y→F
- P01860 Asn-227     Immunoglobulin heavy constant gamma 3 / Homo sapiens
- VAR_003892 226:Y→F
- P01859 Asn-227     Immunoglobulin heavy constant gamma 2 / Homo sapiens
- VAR_003892 226:Y→F
- VAR_003892 226:Y→F
- KTKPREEQFNSTFRV (15aa)
- KRLPEMAQPVDPAHNVSRL (19aa)
- REEQYNSTYRV (11aa)
- EEQYNSTYR (9aa)
- KTKPREEQYNSTYRV (15aa)
- EEQYNSTYR (10aa)
- KEHAVFTSNQEEQDPANHTCGVKS (24aa)
- KMVSHHNLTTGATLINEQWLLTTAKN (26aa)
- KGPNCSEPECPGNCHLRG (18aa)
- KLPPGLLANFTLLRT (15aa)
- RKLPPGLLANFTLLRT (16aa)
- KQIGLYPVLVIDSSGYVNPNYTGRI (25aa)
- GLTFQQNASSM(SO)CVPDQDTAIR (25aa)
- GLTFQQNASSMCVPDQDTAIR (21aa)
- KNLFLNHSENATAKD (15aa)
- KNVSCYIQNLLLGQEKK (17aa)
- KVVLHPNYSQVDIGLIKL (18aa)
- KLENSLLDHRNKT (13aa)
- NGTITDAVDCALDPLSE (17aa)
- RHIGHANLTFEQLRS (15aa)
- REIRHNSTGCLRM (13aa)
- RHNSTGCLRM (10aa)
- KVAYSNDSANWTEYQDPRT (19aa)
- FPNIT (5aa)
- FPNITNLCPFGE (12aa)
- VFNATR (6aa)
- GEVFNATR (8aa)
- KKGNTTLNSFVIPSESDVPTHCPSQWWPYAGHCYKI (36aa)
- RLANLTQGEDQYYLRV (16aa)
- RLSLLEEPGNGTFTVILNQLTSRD (24aa)
- KCGLVPVLAENYNKS (15aa)
- KVPGNVTAVLGETLKV (16aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- KSCHTAVDRTAGWNIPMGLLFNQTGSCKF (29aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
- KRHEEGHMLNCTCFGQGRG (19aa)
- KAAIPSALDTNSSKS (15aa)
- RNSTLDPGKPEMMKS (15aa)
- RHNLTVPGSLRAS (13aa)
- KTAHCNESFYFLCKR (15aa)
- KVEAAQNLTLPGSLRA (16aa)
- KRNDQLPSNFTPVFYSQLQKN (21aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 1787.6503)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Colostrum (UBERON_0001914)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO E1a (CVCL_VU65)
- CHO (CVCL_0213)
- HEK293 (CVCL_0045)
- HEK293T (CVCL_0063)
- Asymptomatic myositis (DOID:633)
- Atopic dermatitis (DOID:3310)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Hyper IgE syndrome (DOID:0080545)
- Hyperimmune condition
- Hypersensitivity reaction disease (DOID:0060056)
- IgE myeloma (DOID:9538)
- Myeloma, Multiple (DOID:9538)
- Myositis (DOID:633)
- Systemic lupus erythematosus (DOID:9074)
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- A Microarray-Matrix-assisted Laser Desorption/Ionization-Mass Spectrometry Approach for Site-specific Protein N-glycosylation Analysis, as Demonstrated for Human Serum Immunoglobulin M (IgM) (2015 - Martin Pabst, Simon Karl Küster, Fabian Wahl, Jasmin Krismer, Petra S.Dittrich, Renato Zenobi) / Status : Reviewed
- A Method for Comprehensive Glycosite-Mapping and Direct Quantitation of Serum Glycoproteins (2015 - Qiuting Hong, L. Renee Ruhaak, Carol Stroble, Evan Parker, Jincui Huang, Emanual Maverakis, Carlito B. Lebrilla) / Status : Reviewed
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
- In-depth analysis of site-specific N-glycosylation in vitronectin from human plasma by tandem mass spectrometry with immunoprecipitation (2014 - Hwang H, Lee JY, Lee HK, Park GW, Jeong HK, Moon MH, Kim JY, Yoo JS.) / Status : Reviewed
- Glycomic analysis of high density lipoprotein shows a highly sialylated particle (2014 - Huang J1, Lee H, Zivkovic AM, Smilowitz JT, Rivera N, German JB, Lebrilla CB) / Status : Reviewed
- Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
- Immunoglobulin G (IgG) Fab Glycosylation Analysis Using a New Mass Spectrometric High-throughput Profiling Method Reveals Pregnancy-associated Changes (2014 - Albert Bondt, Yoann Rombouts, Maurice H.J.Selman, Paul J.Hensbergen, Karli R.Reiding, Johanna M.W.Hazes, Radboud J.E.M.Dolhain, Manfred Wuhrer) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Hypomorphic homozygous mutations in phosphoglucomutase 3 (PGM3) impair immunity and increase serum IgE levels, (2014 - Atfa Sassi, Sandra Lazaroski, Gang Wu, Stuart M. Haslam, Manfred Fliegauf, Fethi Mellouli, Turkan Patiroglu, Ekrem Unal, Mehmet Akif Ozdemir, Zineb Jouhadi, Khadija Khadir, Leila Ben-Khemis, Meriem Ben-Ali, Imen Ben-Mustapha, Lamia Borchani, Dietmar Pfeifer, Thilo Jakob, Monia Khemiri, A. Charlotta Asplund, Manuela O. Gustafsson, Karin E. Lundin, Elin Falk-Sörqvist, Lotte N. Moens, Hatice Eke Gungor, Karin R. Engelhardt, Magdalena Dziadzio, Hans Stauss, Bernhard Fleckenstein, Rebecca Meier, Khairunnadiya Prayitno, Andrea Maul-Pavicic, Sandra Schaffer, Mirzokhid Rakhmanov, Philipp Henneke, Helene Kraus, Hermann Eibel, Uwe Kölsch, Sellama Nadifi, Mats Nilsson, Mohamed Bejaoui, Alejandro A. Schäffer, C.I. Edvard Smith, Anne Dell, Mohamed-Ridha Barbouche, Bodo Grimbacher) / Status : Reviewed
- Site-specific N-glycosylation analysis of human factor XI: Identification of a noncanonical NXC glycosite (2014 - Faid V, Denguir N, Chapuis V, Bihoreau N, Chevreux G) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- Absolute Quantitation of Immunoglobulin G and Its Glycoforms Using Multiple Reaction Monitoring (2013 - Qiuting Hong, Carlito B. Lebrilla, Suzanne Miyamoto, L. Renee Ruhaak) / Status : Reviewed
- Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
- Mass Spectrometric Determination of IgG Subclass-Specific Glycosylation Profiles in Siblings Discordant for Myositis Syndromes (2011 - Irina Perdivara, Shyamal D. Peddada, Frederick W. Miller, Kenneth B. Tomer, Leesa J. Deterding) / Status : Reviewed
- GlycoSpectrumScan: Fishing Glycopeptides from MS Spectra of Protease Digests of Human Colostrum sIgA (2010 - Nandan Deshpande, Pia H. Jensen, Nicolle H. Packer, Daniel Kolarich) / Status : Reviewed
- Differential Glycosylation of Polymeric and Monomeric IgA: A Possible Role in Glomerular Inflammation in IgA Nephropathy (2006 - Beatrijs D. Oortwijn, Anja Roos, Louise Royle, Daniëlle J. van Gijlswijk-Janssen, Maria C. Faber-Krol, Jan-Willem Eijgenraam, Raymond A. Dwek, Mohamed R. Daha, Pauline M. Rudd, Cees van Kooten) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
- A comparative study of the asparagine-linked oligosaccharides on siglec-5, siglec-7 and siglec-8, expressed in a CHO cell line, and their contribution to ligand recognition (2001 - Freeman, Birrell, D Alessio, Erickson-Miller, Kikly, Camilleri) / Status : Reviewed
- ADAM DEC1 / Homo sapiens
- Alpha-1-antichymotrypsin / Homo sapiens
- Alpha-S1-casein / Homo sapiens
- Angiopoietin-related protein 4 / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Angiotensinogen / Homo sapiens
- Butyrophilin subfamily 1 member A1 / Homo sapiens
- Carbonic anhydrase 6 / Homo sapiens
- Chordin-like protein 2 / Homo sapiens
- Clusterin / Homo sapiens
- Coagulation factor XI / Homo sapiens
- Desmocollin-2 / Homo sapiens
- Fibronectin / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Haptoglobin / Homo sapiens
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
- Immunoglobulin epsilon chain c region / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Lactadherin / Homo sapiens
- Lactotransferrin / Homo sapiens
- Leucine-rich alpha-2-glycoprotein / Homo sapiens
- Lipoprotein lipase / Homo sapiens
- Macrophage mannose receptor 1 / Homo sapiens
- Metalloproteinase inhibitor 1 / Homo sapiens
- Monocyte differentiation antigen cd14 / Homo sapiens
- N-acetylglucosamine-1-phosphotransferase subunit gamma / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Recombinant Mucin-1 Muc1f/4tr / Homo sapiens
- Sclerostin domain-containing protein 1 / Homo sapiens
- Serotransferrin / Homo sapiens
-
Sialic acid-binding Ig-like lectin 5 / Homo sapiens
- Undefined site
-
Sialic acid-binding Ig-like lectin 7 / Homo sapiens
- Undefined site
-
Sialic acid-binding Ig-like lectin 8 / Homo sapiens
- Undefined site
- Sulfhydryl oxidase 1 / Homo sapiens
- Tenascin / Homo sapiens
- Tumor necrosis factor ligand superfamily member 13 / Homo sapiens
- Tumor necrosis factor receptor superfamily member 11B / Homo sapiens
- Vitronectin / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- KNVTLHVPSKLDAEKL (16aa)
- KNVTLHVPSKL (11aa)
- YKNNSDISSTR (11aa)
- NNSDISSTR (9aa)
- KNDATEILYSHVVKPVPAHPSSNSTLNQARN (31aa)
- RLSPNASAEHLELRW (15aa)
- KQTDEIKDTRNESTQNCVVAEPEKM (25aa)
- KDTRNESTQNCVVAEPEKMESSISSSSEEMSLSKC (35aa)
- KDTRNESTQNCVVAEPEKM (19aa)
- RNESTQNCVVAEPEKM (16aa)
- RTPEDTAEDTCHLIPGVAESVATCHFNHSSKT (32aa)
- ENISDPTSPLR (11aa)
- RIIVPLNNRENISDPTSPLRT (21aa)
- RENISDPTSPLRT (13aa)
- RIIVPLNNRENISDPTSPLRTRF (23aa)
- KKKEDALNETRE (12aa)
- KKKEDALNETRESETKL (17aa)
- KYEFCPFHNVTQHEQTFRW (19aa)
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- RSHNRSEEFLIAGKL (15aa)
- KNDTLLGIKG (10aa)
- KWECKNDTLLGIKG (14aa)
- KDIVEYYNDSNGSHVLQGRF (20aa)
- KSCQHNGTMYQHGEIFSAHELFPSRL (26aa)
- TQSLLIVNNATNVVIK (16aa)
- KQHSVLHLVPINATSKD (17aa)
- RTLNQSSDELQLSMGNAMFVKE (22aa)
- KNGSGAVFPVAGADVQTLRE (20aa)
- RNVSWATGRS (10aa)
- RTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (32aa)
- RRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (33aa)
- VYSSANNCTFE (11aa)
- REEQFNSTFRV (11aa)
- EEQFNSTFR (9aa)
- VAR_003892 226:Y→F
- P01859 Asn-176     Immunoglobulin heavy constant gamma 2 / Homo sapiens
- VAR_003892 226:Y→F
- VAR_003892 226:Y→F
- P01860 Asn-227     Immunoglobulin heavy constant gamma 3 / Homo sapiens
- VAR_003892 226:Y→F
- P01859 Asn-227     Immunoglobulin heavy constant gamma 2 / Homo sapiens
- VAR_003892 226:Y→F
- VAR_003892 226:Y→F
- KTKPREEQFNSTFRV (15aa)
- KRLPEMAQPVDPAHNVSRL (19aa)
- REEQYNSTYRV (11aa)
- EEQYNSTYR (9aa)
- KTKPREEQYNSTYRV (15aa)
- EEQYNSTYR (10aa)
- KEHAVFTSNQEEQDPANHTCGVKS (24aa)
- KMVSHHNLTTGATLINEQWLLTTAKN (26aa)
- KGPNCSEPECPGNCHLRG (18aa)
- KLPPGLLANFTLLRT (15aa)
- RKLPPGLLANFTLLRT (16aa)
- KQIGLYPVLVIDSSGYVNPNYTGRI (25aa)
- GLTFQQNASSM(SO)CVPDQDTAIR (25aa)
- GLTFQQNASSMCVPDQDTAIR (21aa)
- KNLFLNHSENATAKD (15aa)
- KNVSCYIQNLLLGQEKK (17aa)
- KVVLHPNYSQVDIGLIKL (18aa)
- KLENSLLDHRNKT (13aa)
- NGTITDAVDCALDPLSE (17aa)
- RHIGHANLTFEQLRS (15aa)
- REIRHNSTGCLRM (13aa)
- RHNSTGCLRM (10aa)
- KVAYSNDSANWTEYQDPRT (19aa)
- FPNIT (5aa)
- FPNITNLCPFGE (12aa)
- VFNATR (6aa)
- GEVFNATR (8aa)
- KKGNTTLNSFVIPSESDVPTHCPSQWWPYAGHCYKI (36aa)
- RLANLTQGEDQYYLRV (16aa)
- RLSLLEEPGNGTFTVILNQLTSRD (24aa)
- KCGLVPVLAENYNKS (15aa)
- KVPGNVTAVLGETLKV (16aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- KSCHTAVDRTAGWNIPMGLLFNQTGSCKF (29aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
- KRHEEGHMLNCTCFGQGRG (19aa)
- KAAIPSALDTNSSKS (15aa)
- RNSTLDPGKPEMMKS (15aa)
- RHNLTVPGSLRAS (13aa)
- KTAHCNESFYFLCKR (15aa)
- KVEAAQNLTLPGSLRA (16aa)
- KRNDQLPSNFTPVFYSQLQKN (21aa)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1787.6503)