taxonomy (2)
protein (2)
source (2)
structure (1)
composition (1)
disease (0)
reference (2)
site (2)
peptide (1)
- Latent transforming growth factor beta binding protein 1 / Homo sapiens Q14766
- Toxin Aah6 / Androctonus australis hector P56743
Protein
- Hex:2 HexNAc:2 dHex:2 (avg mass : 1040.9761 )
Composition
Disease
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- Aah VI, a novel, N-glycosylated anti-insect toxin from Androctonus australis hector scorpion venom: isolation, characterisation, and glycan structure determination. (1999 - Hassani O, Loew D, Van Dorsselaer A, Papandrou M, Sorokine O, Rochat H, Sampieri F, Mansuelle P) / Status : Reviewed
Reference
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- Toxin Aah6 / Androctonus australis hector
Reported glycosite
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
Mass spectrometry observed peptide
-
- N-Linked / No-core
(avg mass : 1040.9761)
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- Aah VI, a novel, N-glycosylated anti-insect toxin from Androctonus australis hector scorpion venom: isolation, characterisation, and glycan structure determination. (1999 - Hassani O, Loew D, Van Dorsselaer A, Papandrou M, Sorokine O, Rochat H, Sampieri F, Mansuelle P) / Status : Reviewed
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- Toxin Aah6 / Androctonus australis hector
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / No-core
(avg mass : 1040.9761)