taxonomy (1)
protein (2)
source (2)
structure (1)
composition (1)
disease (0)
reference (2)
site (2)
peptide (1)
- Homo sapiens (Human)
Taxonomy
- Latent transforming growth factor beta binding protein 1 / Homo sapiens Q14766
- T-cell surface glycoprotein cd4 / Homo sapiens P01730
Protein
- N-Linked / Complex / Gal(b1-?)GlcNAc(b1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
Reported structure
- Hex:4 HexNAc:3 (avg mass : 1276.1699 )
Composition
Disease
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- The spectrum of N-linked oligosaccharide structures detected by enzymic microsequencing on a recombinant soluble CD4 glycoprotein from Chinese hamster ovary cells. (1990 - Yuen C, Carr S, Feizi T) / Status : Reviewed
Reference
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
-
T-cell surface glycoprotein cd4 / Homo sapiens
- Undefined site
Reported glycosite
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 1276.1699)
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- The spectrum of N-linked oligosaccharide structures detected by enzymic microsequencing on a recombinant soluble CD4 glycoprotein from Chinese hamster ovary cells. (1990 - Yuen C, Carr S, Feizi T) / Status : Reviewed
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
-
T-cell surface glycoprotein cd4 / Homo sapiens
- Undefined site
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1276.1699)