taxonomy (3)
protein (4)
source (4)
structure (1)
composition (1)
disease (0)
reference (4)
site (4)
peptide (1)
- Interferon omega-1 / Homo sapiens P05000
- Latent transforming growth factor beta binding protein 1 / Homo sapiens Q14766
- Amiloride-sensitive amine oxidase / Sus scrofa Q9TRC7
- Lutropin beta chain / Rana catesbeiana P80071
Protein
- Kidney (UBERON_0002113)
- Ovary (UBERON_0000992) Sf9 (CVCL_0549)
- Pituitary Gland (UBERON_0000007)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
Source
- N-Linked / No-core / Man(a1-?)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
Reported structure
- Hex:2 HexNAc:2 dHex:1 (avg mass : 894.8331 )
Composition
Disease
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
- Simple N-linked sugar chains are bound to the lutropin of the bullfrog rana catesbeiana. (1993 - Hayashi T, Hanakoka Y, Hayashi H) / Status : Reviewed
- Expression of human interferon omega 1 in Sf9 cells. No evidence for complex-type N-linked glycosylation or sialylation. (1993 - Voss T, Erglen E, Ahorn H, Kubelka V, Sugiyama K, Maurer-Fogy I, Glssl J) / Status : Reviewed
Reference
- Interferon omega-1 / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
-
Amiloride-sensitive amine oxidase / Sus scrofa
- Undefined site
- Lutropin beta chain / Rana catesbeiana
Reported glycosite
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
Mass spectrometry observed peptide
-
- N-Linked / No-core (avg mass : 894.8331)
- Kidney (UBERON_0002113)
- Ovary (UBERON_0000992) Sf9 (CVCL_0549)
- Pituitary Gland (UBERON_0000007)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
- Simple N-linked sugar chains are bound to the lutropin of the bullfrog rana catesbeiana. (1993 - Hayashi T, Hanakoka Y, Hayashi H) / Status : Reviewed
- Expression of human interferon omega 1 in Sf9 cells. No evidence for complex-type N-linked glycosylation or sialylation. (1993 - Voss T, Erglen E, Ahorn H, Kubelka V, Sugiyama K, Maurer-Fogy I, Glssl J) / Status : Reviewed
Source
Disease
Reference
