taxonomy (5)
protein (5)
source (13)
structure (1)
composition (1)
disease (3)
reference (9)
site (5)
peptide (1)
- Homo sapiens (Human)
- Sus scrofa (Pig)
- Rana catesbeiana (Bullfrog)
- Gallus gallus (Chicken)
- Drosophila melanogaster (Fruit fly)
Taxonomy
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- Interferon omega-1 / Homo sapiens P05000
- Latent transforming growth factor beta binding protein 1 / Homo sapiens Q14766
- Amiloride-sensitive amine oxidase / Sus scrofa Q9TRC7
- Lutropin beta chain / Rana catesbeiana P80071
Protein
- Ascitic fluid (UBERON_0007795)
- Bone Marrow (UBERON_0002371)
- Colon (UBERON_0001155)
- Embryo (UBERON_0000922)
- Kidney (UBERON_0002113)
- Liver (UBERON_0002107)
- Ovary (UBERON_0000992) Sf9 (CVCL_0549)
- Pituitary Gland (UBERON_0000007)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- LS174T (CVCL_1384)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
Source
- N-Linked / No-core / Man(a1-?)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
Reported structure
- Hex:2 HexNAc:2 dHex:1 (avg mass : 894.8331 )
Composition
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
- Simple N-linked sugar chains are bound to the lutropin of the bullfrog rana catesbeiana. (1993 - Hayashi T, Hanakoka Y, Hayashi H) / Status : Reviewed
- Expression of human interferon omega 1 in Sf9 cells. No evidence for complex-type N-linked glycosylation or sialylation. (1993 - Voss T, Erglen E, Ahorn H, Kubelka V, Sugiyama K, Maurer-Fogy I, Glssl J) / Status : Reviewed
Reference
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Interferon omega-1 / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
-
Amiloride-sensitive amine oxidase / Sus scrofa
- Undefined site
- Lutropin beta chain / Rana catesbeiana
Reported glycosite
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
Mass spectrometry observed peptide
-
- N-Linked / No-core
(avg mass : 894.8331)
- Ascitic fluid (UBERON_0007795)
- Bone Marrow (UBERON_0002371)
- Colon (UBERON_0001155)
- Embryo (UBERON_0000922)
- Kidney (UBERON_0002113)
- Liver (UBERON_0002107)
- Ovary (UBERON_0000992) Sf9 (CVCL_0549)
- Pituitary Gland (UBERON_0000007)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- LS174T (CVCL_1384)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
- Simple N-linked sugar chains are bound to the lutropin of the bullfrog rana catesbeiana. (1993 - Hayashi T, Hanakoka Y, Hayashi H) / Status : Reviewed
- Expression of human interferon omega 1 in Sf9 cells. No evidence for complex-type N-linked glycosylation or sialylation. (1993 - Voss T, Erglen E, Ahorn H, Kubelka V, Sugiyama K, Maurer-Fogy I, Glssl J) / Status : Reviewed
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Interferon omega-1 / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
-
Amiloride-sensitive amine oxidase / Sus scrofa
- Undefined site
- Lutropin beta chain / Rana catesbeiana
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
Source
Reference
Reported glycosite
Mass spectrometry observed peptide
3D structure from GLYCAM
- N-Linked / No-core
(avg mass : 894.8331)