taxonomy (2)
protein (3)
source (3)
structure (1)
composition (1)
disease (1)
reference (3)
site (4)
peptide (1)
- Immunoglobulin epsilon chain c region / Homo sapiens P01854
- Latent transforming growth factor beta binding protein 1 / Homo sapiens Q14766
- Glycoprotein hormones alpha chain - lutropin / Rana catesbeiana P80051
Protein
- Blood Serum (UBERON_0001977)
- Pituitary Gland (UBERON_0000007)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
Source
- N-Linked / No-core / Man(a1-?)Man(b1-4)GlcNAc(b1-4)GlcNAc
Reported structure
- Hex:2 HexNAc:2 (avg mass : 748.6901 )
Composition
- Hyperimmune condition
Disease
- Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- Simple N-linked sugar chains are bound to the lutropin of the bullfrog rana catesbeiana. (1993 - Hayashi T, Hanakoka Y, Hayashi H) / Status : Reviewed
Reference
- Immunoglobulin epsilon chain c region / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- Glycoprotein hormones alpha chain - lutropin / Rana catesbeiana
Reported glycosite
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
Mass spectrometry observed peptide
-
- N-Linked / No-core
(avg mass : 748.6901)
- Blood Serum (UBERON_0001977)
- Pituitary Gland (UBERON_0000007)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- Hyperimmune condition
- Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- Simple N-linked sugar chains are bound to the lutropin of the bullfrog rana catesbeiana. (1993 - Hayashi T, Hanakoka Y, Hayashi H) / Status : Reviewed
- Immunoglobulin epsilon chain c region / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- Glycoprotein hormones alpha chain - lutropin / Rana catesbeiana
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / No-core
(avg mass : 748.6901)