taxonomy (1)
protein (6)
source (3)
structure (1)
composition (1)
disease (0)
reference (2)
site (6)
peptide (2)
- Homo sapiens (Human)
Taxonomy
- IgG1-NK08-V/F genotype / Homo sapiens P01857
- IgG1-NK09-V/F genotype / Homo sapiens P01857
- IgG1-NK11-F/F genotype / Homo sapiens P01857
- IgG1-NK12-V/F genotype / Homo sapiens P01857
- IgG1-NK13-V/F genotype / Homo sapiens P01857
- Latent transforming growth factor beta binding protein 1 / Homo sapiens Q14766
Protein
- Blood Serum (UBERON_0001977) Mature NK T cell (CL_0000814)
- Blood Serum (UBERON_0001977)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
Source
- N-Linked / Complex / GlcNAc(b1-?)Man(a1-3)[GlcNAc(b1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
Reported structure
- Hex:3 HexNAc:4 dHex:1 (avg mass : 1463.3655 )
Composition
Disease
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
Reference
- IgG1-NK08-V/F genotype / Homo sapiens
- IgG1-NK09-V/F genotype / Homo sapiens
- IgG1-NK11-F/F genotype / Homo sapiens
- IgG1-NK12-V/F genotype / Homo sapiens
- IgG1-NK13-V/F genotype / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
Reported glycosite
- TKPREEQYNSTYR (13aa)
- P01857 Asn-180     IgG1-NK12-V/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK11-F/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK08-V/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK13-V/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK09-V/F genotype / Homo sapiens
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 1463.3655)
- Blood Serum (UBERON_0001977) Mature NK T cell (CL_0000814)
- Blood Serum (UBERON_0001977)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- IgG1-NK08-V/F genotype / Homo sapiens
- IgG1-NK09-V/F genotype / Homo sapiens
- IgG1-NK11-F/F genotype / Homo sapiens
- IgG1-NK12-V/F genotype / Homo sapiens
- IgG1-NK13-V/F genotype / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- TKPREEQYNSTYR (13aa)
- P01857 Asn-180     IgG1-NK12-V/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK11-F/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK08-V/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK13-V/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK09-V/F genotype / Homo sapiens
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
Source
Reference
Reported glycosite
Mass spectrometry observed peptide
3D structure from GLYCAM
- N-Linked / Complex
(avg mass : 1463.3655)