taxonomy (9)
protein (10)
source (6)
structure (1)
composition (1)
disease (0)
reference (8)
site (10)
peptide (1)
- Homo sapiens (Human)
- Physomitrella patens
- Apis mellifera (Honeybee)
- Mamestra brassicae
- Spodoptera frugiperda (Fall armyworm)
- Cynodon dactylon (Bermuda grass)
- Juglans regia (English walnut)
- Lupinus luteus (Yellow lupine)
- Prunus dulcis var. sativa (Sweet almond)
Taxonomy
- Latent transforming growth factor beta binding protein 1 / Homo sapiens Q14766
- Uncharacterized protein / Physomitrella patens
- Hyaluronoglucosaminidase / Apis mellifera Q08169
- Phospholipase a2 / Apis mellifera P00630
- Membrane glycoproteins / Mamestra brassicae
- Membrane glycoproteins / Spodoptera frugiperda
- Bg60 / Cynodon dactylon
- Uncharacterized protein / Juglans regia
- Diphosphonucleotide phosphatase / phosphodiesterase / Lupinus luteus
- Uncharacterized protein / Prunus dulcis var. sativa
Protein
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Venom (UBERON_0007113)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- Pollen (BTO_0001097)
- Seed (BTO_0001226)
Source
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)]GlcNAc
Reported structure
- Hex:3 HexNAc:2 dHex:1 (avg mass : 1056.9755 )
Composition
Disease
- Protein N-glycosylation is similar in the moss Physcomitrella patens and in higher plants. (2003 - Vietor R, Loutelier-Bourhis C, Fitchette AC, Margerie P, Gonneau M, Faye L, Lerouge P) / Status : Reviewed
- Analysis of Asn-linked glycans from vegetable foodstuffs: widespread occurrence of Lewis a, core alpha1,3-linked fucose and xylose substitutions. (2001 - Wilson IB, Zeleny R, Kolarich D, Staudacher E, Stroop CJ, Kamerling JP, Altmann F) / Status : Reviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- Structural analysis of N-glycans from yellow lupin (Lupinus luteus) seed diphosphonucleotide phosphatase/phosphodiesterase. (2000 - Olczak M, Watorek W) / Status : Reviewed
- The carbohydrate moiety of the bermuda grass antigen BG60. New oligosaccharides of plant origin. (1996 - Ohsuga H, Su S, Takahashi N, Yang S, Nakagawa H, Shimada I, Arata Y, Lee Y) / Status : Reviewed
- The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
- Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
- Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
Reference
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
-
Uncharacterized protein / Physomitrella patens
- Undefined site
-
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
- Phospholipase a2 / Apis mellifera
-
Membrane glycoproteins / Mamestra brassicae
- Undefined site
-
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
-
Bg60 / Cynodon dactylon
- Undefined site
-
Uncharacterized protein / Juglans regia
- Undefined site
-
Diphosphonucleotide phosphatase / phosphodiesterase / Lupinus luteus
- Undefined site
-
Uncharacterized protein / Prunus dulcis var. sativa
- Undefined site
Reported glycosite
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
Mass spectrometry observed peptide
-
- N-Linked / Pauci-Mannose
(avg mass : 1056.9755)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Venom (UBERON_0007113)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- Pollen (BTO_0001097)
- Seed (BTO_0001226)
- Protein N-glycosylation is similar in the moss Physcomitrella patens and in higher plants. (2003 - Vietor R, Loutelier-Bourhis C, Fitchette AC, Margerie P, Gonneau M, Faye L, Lerouge P) / Status : Reviewed
- Analysis of Asn-linked glycans from vegetable foodstuffs: widespread occurrence of Lewis a, core alpha1,3-linked fucose and xylose substitutions. (2001 - Wilson IB, Zeleny R, Kolarich D, Staudacher E, Stroop CJ, Kamerling JP, Altmann F) / Status : Reviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- Structural analysis of N-glycans from yellow lupin (Lupinus luteus) seed diphosphonucleotide phosphatase/phosphodiesterase. (2000 - Olczak M, Watorek W) / Status : Reviewed
- The carbohydrate moiety of the bermuda grass antigen BG60. New oligosaccharides of plant origin. (1996 - Ohsuga H, Su S, Takahashi N, Yang S, Nakagawa H, Shimada I, Arata Y, Lee Y) / Status : Reviewed
- The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
- Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
- Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
-
Uncharacterized protein / Physomitrella patens
- Undefined site
-
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
- Phospholipase a2 / Apis mellifera
-
Membrane glycoproteins / Mamestra brassicae
- Undefined site
-
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
-
Bg60 / Cynodon dactylon
- Undefined site
-
Uncharacterized protein / Juglans regia
- Undefined site
-
Diphosphonucleotide phosphatase / phosphodiesterase / Lupinus luteus
- Undefined site
-
Uncharacterized protein / Prunus dulcis var. sativa
- Undefined site
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
Source
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Pauci-Mannose
(avg mass : 1056.9755)