taxonomy (2)
protein (3)
source (3)
structure (1)
composition (1)
disease (0)
reference (2)
site (3)
peptide (1)
- Latent transforming growth factor beta binding protein 1 / Homo sapiens Q14766
- T-cell surface glycoprotein cd4 / Rattus norvegicus P05540
- Thy-1 membrane glycoprotein / Rattus norvegicus
Protein
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
Source
- Hex:3 HexNAc:3 (avg mass : 1114.0275 )
Composition
Disease
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
Reference
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
-
T-cell surface glycoprotein cd4 / Rattus norvegicus
- Undefined site
-
Thy-1 membrane glycoprotein / Rattus norvegicus
- Undefined site
Reported glycosite
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 1114.0275)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
-
T-cell surface glycoprotein cd4 / Rattus norvegicus
- Undefined site
-
Thy-1 membrane glycoprotein / Rattus norvegicus
- Undefined site
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
Source
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1114.0275)