taxonomy (29)
protein (49)
source (37)
structure (1)
composition (1)
disease (10)
reference (51)
site (54)
peptide (9)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Cricetulus griseus (Chinese hamster)
- Felis catus (Cat)
- Mus musculus (House mouse)
- Rattus norvegicus (Norway rat)
- Nicotiana alata (Persian tobacco)
- Coturnix coturnix (Quail)
- Gallus gallus (Chicken)
- Physomitrella patens
- Caenorhabditis elegans
- Trichinella spiralis
- Helix pomatia (Roman snail)
- Megathura crenulata (Californian giant keyhole limpet)
- Antheraea pernyi (Chinese oak silkmoth)
- Apis mellifera (Honeybee)
- Bombyx mori (Domestic silkworm)
- Drosophila melanogaster (Fruit fly)
- Drosophila melanogaster (Df(2R)achi2 mutant) (Fruit fly)
- Drosophila melanogaster (fdl mutant) (Fruit fly)
- Mamestra brassicae
- Spodoptera frugiperda (Fall armyworm)
- Human immunodeficiency virus (Hiv)
- Armoracia rusticana (Horseradish)
- Lupinus luteus (Yellow lupine)
- Phaseolus vulgaris (Kidney bean)
- Influenza a virus (strain a/fowl plague virus/rostock/34)
- Semliki forest virus
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Alpha-n-acetylgalactosaminidase / Homo sapiens P17050
- Beta-secretase / Homo sapiens P56817
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- Haptoglobin / Homo sapiens P00738
- Hemopexin / Homo sapiens P02790
- Immunoglobulin epsilon chain c region / Homo sapiens P01854
- Lactotransferrin / Homo sapiens P02788
- Latent transforming growth factor beta binding protein 1 / Homo sapiens Q14766
- Plasminogen / Homo sapiens P00747
- Prorenin / Homo sapiens P00797
- Prosaposin / Homo sapiens P07602
- Serotransferrin / Homo sapiens P02787
- Lactotransferrin / Bos taurus P24627
- Uncharacterized protein from Ovary / Cricetulus griseus
- Uncharacterized protein from Ovary / Cricetulus griseus
- Interferon beta / Mus musculus P01575
- Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus P08289
- Mrc ox-45 surface antigen / Rattus norvegicus P10252
- T-cell surface glycoprotein cd4 / Rattus norvegicus P05540
- Uncharacterized protein from Epidiymis / Rattus norvegicus
- Uncharacterized protein from Testis / Rattus norvegicus
- Ribonuclease s-6 / Nicotiana alata Q40379
- Ovomucoid / Coturnix coturnix
- Ovalbumin / Gallus gallus P01012
- Ovomucoid / Gallus gallus P01005
- Riboflavin-binding protein / Gallus gallus P02752
- Uncharacterized protein / Gallus gallus
- Uncharacterized protein / Physomitrella patens
- Uncharacterized protein / Caenorhabditis elegans
- Tsl-1 antigens / Trichinella spiralis
- Uncharacterized protein / Trichinella spiralis
- Hemocyanin, alpha-d chain / Helix pomatia
- Hemocyanin / Megathura crenulata Q10584 Q10583
- Arylphorin / Antheraea pernyi Q7Z1F8
- Uncharacterized protein from Hemolymph / Antheraea pernyi
- Hyaluronoglucosaminidase / Apis mellifera Q08169
- Phospholipase a2 / Apis mellifera P00630
- Membrane glycoproteins / Bombyx mori
- Uncharacterized protein / Drosophila melanogaster
- Membrane glycoproteins / Mamestra brassicae
- Membrane glycoproteins / Spodoptera frugiperda
- Surface protein gp120 / Human immunodeficiency virus
- Peroxidase c1a / Armoracia rusticana P00433
- Diphosphonucleotide phosphatase / phosphodiesterase / Lupinus luteus
- Alpha-amylase inhibitor, chain 2 / Phaseolus vulgaris P02873
- Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34) P03459
- Spike glycoprotein e1 / Semliki forest virus P03315
- Spike glycoprotein e2 / Semliki forest virus P03315
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Ascitic fluid (UBERON_0007795)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Colon (UBERON_0001155)
- Embryo (UBERON_0000922)
- Epidiymis (UBERON_0001301)
- Hemolymph (UBERON_0001011)
- Liver (UBERON_0002107) AH130 (CVCL_4367)
- Liver (UBERON_0002107)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO-DG44 (CVCL_7180)
- Ovary (UBERON_0000992) PIR-P3 (CVCL_DD11)
- Ovary (UBERON_0000992) PIR-P8 (CVCL_IQ79)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Ovary (UBERON_0000992) Sf9 (CVCL_0549)
- Ovary (UBERON_0000992)
- Spleen (UBERON_0002106)
- Testis (UBERON_0000473)
- Urine (UBERON_0001088)
- Venom (UBERON_0007113)
- BM-N (CVCL_Z633)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- BTI-Tn-5B1-4 (CVCL_C190)
- C6/36 (CVCL_Z230)
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- LS174T (CVCL_1384)
- SPC-Mb-92-C6 (CVCL_VT62)
- Sf21 (CVCL_0518)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Egg Cell
- Egg Cell Egg White
- Seed (BTO_0001226)
- Style (BTO_0001313)
Source
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
Reported structure
- Hex:3 HexNAc:2 (avg mass : 910.8325 )
Composition
- Carcinoma, Hepatocellular (DOID:684)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Gaucher Disease (DOID:1926)
- Hyperimmune condition
- IgE myeloma (DOID:9538)
- Mannosidosis, alpha (DOID:3413)
- Mixed phenotype acute leukemia (DOID:9953)
- Multiple myeloma (DOID:9538)
Disease
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
- Exploring site-specific N-glycosylation microheterogeneity of haptoglobin using glycopeptide CID tandem mass spectra and glycan database search (2013 - Chandler KB1, Pompach P, Goldman R, Edwards N.) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- The Drosophila fused lobes gene encodes an N-acetylglucosaminidase involved in N-glycan processing. (2006 - Renaud Léonard, Dubravko Rendic, Catherine Rabouille, Iain B H Wilson, Thomas Préat, Friedrich Altmann) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
- Protein N-glycosylation is similar in the moss Physcomitrella patens and in higher plants. (2003 - Vietor R, Loutelier-Bourhis C, Fitchette AC, Margerie P, Gonneau M, Faye L, Lerouge P) / Status : Reviewed
- N-linked glycan structures of mouse interferon-beta produced by Bombyx mori larvae. (2003 - Misaki R, Nagaya H, Fujiyama K, Yanagihara I, Honda T, Seki T) / Status : Reviewed
- Structural determination of the N-glycans of a lepidopteran arylphorin reveals the presence of a monoglucosylated oligosaccharide in the storage protein. (2003 - Kim S, Hwang SK, Dwek RA, Rudd PM, Ahn YH, Kim EH, Cheong C, Kim SI, Park NS, Lee SM) / Status : Reviewed
- Structural analysis of N-linked glycans in Caenorhabditis elegans (2002 - Natsuka S, Adachi J, Kawaguchi M, Nakakita S, Hase S, Ichikawa A, Ikura K) / Status : Reviewed
- Hemocyanin from the keyhole limpet Megathura crenulata (KLH) carries a novel type of N-glycans with Gal(beta1-6)Man-motifs. (2002 - Kurokawa T, Wuhrer M, Lochnit G, Geyer H, Markl J, Geyer R) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- Characterization of the glycosylation profiles of Alzheimer's beta -secretase protein Asp-2 expressed in a variety of cell lines. (2001 - Charlwood J, Dingwall C, Matico R, Hussain I, Johanson K, Moore S, Powell DJ, Skehel JM, Ratcliffe S, Clarke B, Trill J, Sweitzer S, Camilleri P) / Status : Reviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- Characterization of the N-linked glycans of adult Trichinella spiralis. (2000 - Morelle W, Haslam S, Morris H, Dell A) / Status : Reviewed
- Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
- Structural analysis of N-glycans from yellow lupin (Lupinus luteus) seed diphosphonucleotide phosphatase/phosphodiesterase. (2000 - Olczak M, Watorek W) / Status : Reviewed
- N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- New N-glycans in horseradish peroxidase. (1998 - Takahashi N, Lee K, Nakagawa H, Tsukamoto Y, Masuda K, Lee Y) / Status : Reviewed
- Structural characterization of the N-linked oligosaccharides derived from HIVgp120 expressed in lepidopteran cells. (1998 - Butters T, Yudkin B, Jacob G, Jones I) / Status : Reviewed
- Primary structure of 21 novel monoantennary and diantennary N-linked carbohydrate chains from alphaD-hemocyanin of Helix pomatia. (1997 - Lommerse J, Thomas-Oates J, Gielens C, Praux G, Kamerling J, Vliegenthart J) / Status : Reviewed
- Microheterogeneity of the oligosaccharides carried by the recombinant bovine lactoferrin expressed in Mamestra brassicae cells. (1997 - Lopez M, Coddeville B, Langridge J, Plancke Y, Sautire P, Chaabihi H, Chirat F, Harduin-Lepers A, Cerutti M, Verbert A, Delannoy P) / Status : Reviewed
- Structure of N-glycans on the S3- and S6-allele stylar self-incompatibility ribonucleases of Nicotiana alata. (1996 - Oxley D, Munro S, Craik D, Bacic A) / Status : Reviewed
- Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
- The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
- Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
- Glycosylation of recombinant prorenin in insect cells: the insect cell line Sf9 does not express the mannose 6-phosphate recognition signal. (1994 - Aeed P, Elhammer A) / Status : Reviewed
- Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Characterization of the oligosaccharide structures on bee venom phospholipase A2. (1993 - Hollander T, Aeed P, Elhammer A) / Status : Reviewed
- Asparagine-linked oligosaccharides of Semliki Forest virus grown in mosquito cells. (1992 - Naim HY, Koblet H) / Status : Reviewed
- Structures of sugar chains of the subunits of an alpha-amylase inhibitor from Phaseolus vulgaris white kidney beans. (1992 - Yamaguchi H, Funaoka H, Iwamoto H) / Status : Reviewed
- Structures of the asparagine-289-linked oligosaccharides assembled on recombinant human plasminogen expressed in a Mamestra brassicae cell line (IZD-MBO503). (1991 - Davidson D, Castellino F) / Status : Reviewed
- Isolation of Chinese hamster ovary cell lines producing Man3GlcNAc2 asparagine-linked glycans. (1991 - Zeng Y, Lehrman M) / Status : Reviewed
- Asparagine-linked oligosaccharide processing in lepidopteran insect cells. Temporal dependence of the nature of the oligosaccharides assembled on asparagine-289 of recombinant human plasminogen produced in baculovirus vector infected Spodoptera frugiperda (IPLB-SF-21AE) cells. (1991 - Davidson D, Castellino F) / Status : Reviewed
- Oligosaccharide structures present on asparagine-289 of recombinant human plasminogen expressed in a Chinese hamster ovary cell line. (1991 - Davidson D, Castellino F) / Status : Reviewed
- Different oligosaccharides accumulate in the brain and urine of a cat with alpha-mannosidosis: structure determination of five brain-derived and seventeen urinary oligosaccharides. (1991 - Hard K, Mekking A, Kamerling J, Dacremont G, Vliegenthart J) / Status : Reviewed
- Oligosaccharide processing in the expression of human plasminogen cDNA by lepidopteran insect (Spodoptera frugiperda) cells. (1990 - Davidson D, Fraser M, Castellino F) / Status : Reviewed
- Swainsonine induces the production of hybrid glycoproteins and accumulation of oligosaccharides in male reproductive tissues of the rat. (1990 - Tulsiani DR, Skudlarek MD, Orgebin-Crist MC) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- The oligosaccharides of influenza virus hemagglutinin expressed in insect cells by a baculovirus vector. (1990 - Kuroda K, Geyer H, Geyer R, Doerfler W, Klenk H) / Status : Reviewed
- Carbohydrate structures of quail ovomucoid. Characterization of degraded oligosaccharides produced during alkaline hydrolysis of the asparaginyl-N-acetylglucosamine linkage. (1990 - Alonso J, Boulengueur P, Wieruszeski J, Leroy Y, Montreuil J, Fournet B) / Status : Reviewed
- Structural studies of the sugar chains of hen ovomucoid. Evidence indicating that they are formed mainly by the alternate biosynthetic pathway of asparagine-linked sugar chains. (1983 - Yamashita K, Kamerling JP, Kobata A) / Status : Reviewed
- Preparation and characterisation of fragment glycoasparagines from ovalbumin glycopeptides: reference compounds for structural and biochemical studies of the oligo-mannose and hybrid types of carbohydrate chains of glycoproteins. (1982 - Nomoto H, Endo T, Inoue Y) / Status : Reviewed
Reference
-
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
-
Beta-secretase / Homo sapiens
- Undefined site
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Haptoglobin / Homo sapiens
- Hemopexin / Homo sapiens
- Immunoglobulin epsilon chain c region / Homo sapiens
- Lactotransferrin / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
-
Plasminogen / Homo sapiens
- Undefined site
-
Prorenin / Homo sapiens
- Undefined site
-
Prosaposin / Homo sapiens
- Undefined site
-
Serotransferrin / Homo sapiens
- Undefined site
- Lactotransferrin / Bos taurus
-
Uncharacterized protein from Ovary / Cricetulus griseus
- Undefined site
-
Uncharacterized protein from Ovary / Cricetulus griseus
- Undefined site
-
Interferon beta / Mus musculus
- Undefined site
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
T-cell surface glycoprotein cd4 / Rattus norvegicus
- Undefined site
-
Uncharacterized protein from Epidiymis / Rattus norvegicus
- Undefined site
-
Uncharacterized protein from Testis / Rattus norvegicus
- Undefined site
-
Ribonuclease s-6 / Nicotiana alata
- Undefined site
-
Ovomucoid / Coturnix coturnix
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein / Gallus gallus
- Undefined site
-
Uncharacterized protein / Physomitrella patens
- Undefined site
-
Uncharacterized protein / Caenorhabditis elegans
- Undefined site
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
Uncharacterized protein / Trichinella spiralis
- Undefined site
-
Hemocyanin, alpha-d chain / Helix pomatia
- Undefined site
-
Hemocyanin / Megathura crenulata
- Undefined site
-
Arylphorin / Antheraea pernyi
- Undefined site
-
Uncharacterized protein from Hemolymph / Antheraea pernyi
- Undefined site
-
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
- Phospholipase a2 / Apis mellifera
-
Membrane glycoproteins / Bombyx mori
- Undefined site
-
Uncharacterized protein / Drosophila melanogaster
- Undefined site
-
Membrane glycoproteins / Mamestra brassicae
- Undefined site
-
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
-
Surface protein gp120 / Human immunodeficiency virus
- Undefined site
-
Peroxidase c1a / Armoracia rusticana
- Undefined site
-
Diphosphonucleotide phosphatase / phosphodiesterase / Lupinus luteus
- Undefined site
-
Alpha-amylase inhibitor, chain 2 / Phaseolus vulgaris
- Undefined site
-
Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)
- Undefined site
-
Spike glycoprotein e1 / Semliki forest virus
- Undefined site
-
Spike glycoprotein e2 / Semliki forest virus
- Undefined site
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
-
- N-Linked / Pauci-Mannose
(avg mass : 910.8325)
- Ascitic fluid (UBERON_0007795)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Colon (UBERON_0001155)
- Embryo (UBERON_0000922)
- Epidiymis (UBERON_0001301)
- Hemolymph (UBERON_0001011)
- Liver (UBERON_0002107) AH130 (CVCL_4367)
- Liver (UBERON_0002107)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO-DG44 (CVCL_7180)
- Ovary (UBERON_0000992) PIR-P3 (CVCL_DD11)
- Ovary (UBERON_0000992) PIR-P8 (CVCL_IQ79)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Ovary (UBERON_0000992) Sf9 (CVCL_0549)
- Ovary (UBERON_0000992)
- Spleen (UBERON_0002106)
- Testis (UBERON_0000473)
- Urine (UBERON_0001088)
- Venom (UBERON_0007113)
- BM-N (CVCL_Z633)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- BTI-Tn-5B1-4 (CVCL_C190)
- C6/36 (CVCL_Z230)
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- LS174T (CVCL_1384)
- SPC-Mb-92-C6 (CVCL_VT62)
- Sf21 (CVCL_0518)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Egg Cell
- Egg Cell Egg White
- Seed (BTO_0001226)
- Style (BTO_0001313)
- Carcinoma, Hepatocellular (DOID:684)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Gaucher Disease (DOID:1926)
- Hyperimmune condition
- IgE myeloma (DOID:9538)
- Mannosidosis, alpha (DOID:3413)
- Mixed phenotype acute leukemia (DOID:9953)
- Multiple myeloma (DOID:9538)
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
- Exploring site-specific N-glycosylation microheterogeneity of haptoglobin using glycopeptide CID tandem mass spectra and glycan database search (2013 - Chandler KB1, Pompach P, Goldman R, Edwards N.) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- The Drosophila fused lobes gene encodes an N-acetylglucosaminidase involved in N-glycan processing. (2006 - Renaud Léonard, Dubravko Rendic, Catherine Rabouille, Iain B H Wilson, Thomas Préat, Friedrich Altmann) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
- Protein N-glycosylation is similar in the moss Physcomitrella patens and in higher plants. (2003 - Vietor R, Loutelier-Bourhis C, Fitchette AC, Margerie P, Gonneau M, Faye L, Lerouge P) / Status : Reviewed
- N-linked glycan structures of mouse interferon-beta produced by Bombyx mori larvae. (2003 - Misaki R, Nagaya H, Fujiyama K, Yanagihara I, Honda T, Seki T) / Status : Reviewed
- Structural determination of the N-glycans of a lepidopteran arylphorin reveals the presence of a monoglucosylated oligosaccharide in the storage protein. (2003 - Kim S, Hwang SK, Dwek RA, Rudd PM, Ahn YH, Kim EH, Cheong C, Kim SI, Park NS, Lee SM) / Status : Reviewed
- Structural analysis of N-linked glycans in Caenorhabditis elegans (2002 - Natsuka S, Adachi J, Kawaguchi M, Nakakita S, Hase S, Ichikawa A, Ikura K) / Status : Reviewed
- Hemocyanin from the keyhole limpet Megathura crenulata (KLH) carries a novel type of N-glycans with Gal(beta1-6)Man-motifs. (2002 - Kurokawa T, Wuhrer M, Lochnit G, Geyer H, Markl J, Geyer R) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- Characterization of the glycosylation profiles of Alzheimer's beta -secretase protein Asp-2 expressed in a variety of cell lines. (2001 - Charlwood J, Dingwall C, Matico R, Hussain I, Johanson K, Moore S, Powell DJ, Skehel JM, Ratcliffe S, Clarke B, Trill J, Sweitzer S, Camilleri P) / Status : Reviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- Characterization of the N-linked glycans of adult Trichinella spiralis. (2000 - Morelle W, Haslam S, Morris H, Dell A) / Status : Reviewed
- Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
- Structural analysis of N-glycans from yellow lupin (Lupinus luteus) seed diphosphonucleotide phosphatase/phosphodiesterase. (2000 - Olczak M, Watorek W) / Status : Reviewed
- N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- New N-glycans in horseradish peroxidase. (1998 - Takahashi N, Lee K, Nakagawa H, Tsukamoto Y, Masuda K, Lee Y) / Status : Reviewed
- Structural characterization of the N-linked oligosaccharides derived from HIVgp120 expressed in lepidopteran cells. (1998 - Butters T, Yudkin B, Jacob G, Jones I) / Status : Reviewed
- Primary structure of 21 novel monoantennary and diantennary N-linked carbohydrate chains from alphaD-hemocyanin of Helix pomatia. (1997 - Lommerse J, Thomas-Oates J, Gielens C, Praux G, Kamerling J, Vliegenthart J) / Status : Reviewed
- Microheterogeneity of the oligosaccharides carried by the recombinant bovine lactoferrin expressed in Mamestra brassicae cells. (1997 - Lopez M, Coddeville B, Langridge J, Plancke Y, Sautire P, Chaabihi H, Chirat F, Harduin-Lepers A, Cerutti M, Verbert A, Delannoy P) / Status : Reviewed
- Structure of N-glycans on the S3- and S6-allele stylar self-incompatibility ribonucleases of Nicotiana alata. (1996 - Oxley D, Munro S, Craik D, Bacic A) / Status : Reviewed
- Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
- The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
- Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
- Glycosylation of recombinant prorenin in insect cells: the insect cell line Sf9 does not express the mannose 6-phosphate recognition signal. (1994 - Aeed P, Elhammer A) / Status : Reviewed
- Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Characterization of the oligosaccharide structures on bee venom phospholipase A2. (1993 - Hollander T, Aeed P, Elhammer A) / Status : Reviewed
- Asparagine-linked oligosaccharides of Semliki Forest virus grown in mosquito cells. (1992 - Naim HY, Koblet H) / Status : Reviewed
- Structures of sugar chains of the subunits of an alpha-amylase inhibitor from Phaseolus vulgaris white kidney beans. (1992 - Yamaguchi H, Funaoka H, Iwamoto H) / Status : Reviewed
- Structures of the asparagine-289-linked oligosaccharides assembled on recombinant human plasminogen expressed in a Mamestra brassicae cell line (IZD-MBO503). (1991 - Davidson D, Castellino F) / Status : Reviewed
- Isolation of Chinese hamster ovary cell lines producing Man3GlcNAc2 asparagine-linked glycans. (1991 - Zeng Y, Lehrman M) / Status : Reviewed
- Asparagine-linked oligosaccharide processing in lepidopteran insect cells. Temporal dependence of the nature of the oligosaccharides assembled on asparagine-289 of recombinant human plasminogen produced in baculovirus vector infected Spodoptera frugiperda (IPLB-SF-21AE) cells. (1991 - Davidson D, Castellino F) / Status : Reviewed
- Oligosaccharide structures present on asparagine-289 of recombinant human plasminogen expressed in a Chinese hamster ovary cell line. (1991 - Davidson D, Castellino F) / Status : Reviewed
- Different oligosaccharides accumulate in the brain and urine of a cat with alpha-mannosidosis: structure determination of five brain-derived and seventeen urinary oligosaccharides. (1991 - Hard K, Mekking A, Kamerling J, Dacremont G, Vliegenthart J) / Status : Reviewed
- Oligosaccharide processing in the expression of human plasminogen cDNA by lepidopteran insect (Spodoptera frugiperda) cells. (1990 - Davidson D, Fraser M, Castellino F) / Status : Reviewed
- Swainsonine induces the production of hybrid glycoproteins and accumulation of oligosaccharides in male reproductive tissues of the rat. (1990 - Tulsiani DR, Skudlarek MD, Orgebin-Crist MC) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- The oligosaccharides of influenza virus hemagglutinin expressed in insect cells by a baculovirus vector. (1990 - Kuroda K, Geyer H, Geyer R, Doerfler W, Klenk H) / Status : Reviewed
- Carbohydrate structures of quail ovomucoid. Characterization of degraded oligosaccharides produced during alkaline hydrolysis of the asparaginyl-N-acetylglucosamine linkage. (1990 - Alonso J, Boulengueur P, Wieruszeski J, Leroy Y, Montreuil J, Fournet B) / Status : Reviewed
- Structural studies of the sugar chains of hen ovomucoid. Evidence indicating that they are formed mainly by the alternate biosynthetic pathway of asparagine-linked sugar chains. (1983 - Yamashita K, Kamerling JP, Kobata A) / Status : Reviewed
- Preparation and characterisation of fragment glycoasparagines from ovalbumin glycopeptides: reference compounds for structural and biochemical studies of the oligo-mannose and hybrid types of carbohydrate chains of glycoproteins. (1982 - Nomoto H, Endo T, Inoue Y) / Status : Reviewed
-
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
-
Beta-secretase / Homo sapiens
- Undefined site
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Haptoglobin / Homo sapiens
- Hemopexin / Homo sapiens
- Immunoglobulin epsilon chain c region / Homo sapiens
- Lactotransferrin / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
-
Plasminogen / Homo sapiens
- Undefined site
-
Prorenin / Homo sapiens
- Undefined site
-
Prosaposin / Homo sapiens
- Undefined site
-
Serotransferrin / Homo sapiens
- Undefined site
- Lactotransferrin / Bos taurus
-
Uncharacterized protein from Ovary / Cricetulus griseus
- Undefined site
-
Uncharacterized protein from Ovary / Cricetulus griseus
- Undefined site
-
Interferon beta / Mus musculus
- Undefined site
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
T-cell surface glycoprotein cd4 / Rattus norvegicus
- Undefined site
-
Uncharacterized protein from Epidiymis / Rattus norvegicus
- Undefined site
-
Uncharacterized protein from Testis / Rattus norvegicus
- Undefined site
-
Ribonuclease s-6 / Nicotiana alata
- Undefined site
-
Ovomucoid / Coturnix coturnix
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein / Gallus gallus
- Undefined site
-
Uncharacterized protein / Physomitrella patens
- Undefined site
-
Uncharacterized protein / Caenorhabditis elegans
- Undefined site
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
Uncharacterized protein / Trichinella spiralis
- Undefined site
-
Hemocyanin, alpha-d chain / Helix pomatia
- Undefined site
-
Hemocyanin / Megathura crenulata
- Undefined site
-
Arylphorin / Antheraea pernyi
- Undefined site
-
Uncharacterized protein from Hemolymph / Antheraea pernyi
- Undefined site
-
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
- Phospholipase a2 / Apis mellifera
-
Membrane glycoproteins / Bombyx mori
- Undefined site
-
Uncharacterized protein / Drosophila melanogaster
- Undefined site
-
Membrane glycoproteins / Mamestra brassicae
- Undefined site
-
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
-
Surface protein gp120 / Human immunodeficiency virus
- Undefined site
-
Peroxidase c1a / Armoracia rusticana
- Undefined site
-
Diphosphonucleotide phosphatase / phosphodiesterase / Lupinus luteus
- Undefined site
-
Alpha-amylase inhibitor, chain 2 / Phaseolus vulgaris
- Undefined site
-
Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)
- Undefined site
-
Spike glycoprotein e1 / Semliki forest virus
- Undefined site
-
Spike glycoprotein e2 / Semliki forest virus
- Undefined site
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- RNGTGHGNSTHHGPEYMRC (19aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- DFGGFNFSQILPDPSKPSK (19aa)
- KNFTTAPAICHDGK (14aa)
- NFTTAPAICHDGK (13aa)
- GVFVSNGTHWFVTQR (15aa)
- NHTSPDVDLGDISGINASVVNIQK (24aa)
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
3D structure from GLYCAM
- N-Linked / Pauci-Mannose
(avg mass : 910.8325)