GlyConnect

taxonomy (26) protein (46) source (26) structure (1) composition (1) disease (6) reference (43) site (47) peptide (1)

Taxonomy

Protein

Source

Reported structure

N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc

Composition

Hex:3 HexNAc:2 (avg mass : 910.8325 )

Disease

Reference

Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
Exploring site-specific N-glycosylation microheterogeneity of haptoglobin using glycopeptide CID tandem mass spectra and glycan database search (2013 - Chandler KB1, Pompach P, Goldman R, Edwards N.) / Status : Reviewed
Structural determination of the N-glycans of a lepidopteran arylphorin reveals the presence of a monoglucosylated oligosaccharide in the storage protein. (2003 - Kim S, Hwang SK, Dwek RA, Rudd PM, Ahn YH, Kim EH, Cheong C, Kim SI, Park NS, Lee SM) / Status : Reviewed
N-linked glycan structures of mouse interferon-beta produced by Bombyx mori larvae. (2003 - Misaki R, Nagaya H, Fujiyama K, Yanagihara I, Honda T, Seki T) / Status : Reviewed
Protein N-glycosylation is similar in the moss Physcomitrella patens and in higher plants. (2003 - Vietor R, Loutelier-Bourhis C, Fitchette AC, Margerie P, Gonneau M, Faye L, Lerouge P) / Status : Reviewed
Hemocyanin from the keyhole limpet Megathura crenulata (KLH) carries a novel type of N-glycans with Gal(beta1-6)Man-motifs. (2002 - Kurokawa T, Wuhrer M, Lochnit G, Geyer H, Markl J, Geyer R) / Status : Reviewed
Structural analysis of N-linked glycans in Caenorhabditis elegans (2002 - Natsuka S, Adachi J, Kawaguchi M, Nakakita S, Hase S, Ichikawa A, Ikura K) / Status : Reviewed
Characterization of the glycosylation profiles of Alzheimer's beta -secretase protein Asp-2 expressed in a variety of cell lines. (2001 - Charlwood J, Dingwall C, Matico R, Hussain I, Johanson K, Moore S, Powell DJ, Skehel JM, Ratcliffe S, Clarke B, Trill J, Sweitzer S, Camilleri P) / Status : Reviewed
Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
Structural analysis of N-glycans from yellow lupin (Lupinus luteus) seed diphosphonucleotide phosphatase/phosphodiesterase. (2000 - Olczak M, Watorek W) / Status : Reviewed
Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
Characterization of the N-linked glycans of adult Trichinella spiralis. (2000 - Morelle W, Haslam S, Morris H, Dell A) / Status : Reviewed
Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
Structural characterization of the N-linked oligosaccharides derived from HIVgp120 expressed in lepidopteran cells. (1998 - Butters T, Yudkin B, Jacob G, Jones I) / Status : Reviewed
New N-glycans in horseradish peroxidase. (1998 - Takahashi N, Lee K, Nakagawa H, Tsukamoto Y, Masuda K, Lee Y) / Status : Reviewed
Primary structure of 21 novel monoantennary and diantennary N-linked carbohydrate chains from alphaD-hemocyanin of Helix pomatia. (1997 - Lommerse J, Thomas-Oates J, Gielens C, Praux G, Kamerling J, Vliegenthart J) / Status : Reviewed
Microheterogeneity of the oligosaccharides carried by the recombinant bovine lactoferrin expressed in Mamestra brassicae cells. (1997 - Lopez M, Coddeville B, Langridge J, Plancke Y, Sautire P, Chaabihi H, Chirat F, Harduin-Lepers A, Cerutti M, Verbert A, Delannoy P) / Status : Reviewed
Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
Structure of N-glycans on the S3- and S6-allele stylar self-incompatibility ribonucleases of Nicotiana alata. (1996 - Oxley D, Munro S, Craik D, Bacic A) / Status : Reviewed
The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
Glycosylation of recombinant prorenin in insect cells: the insect cell line Sf9 does not express the mannose 6-phosphate recognition signal. (1994 - Aeed P, Elhammer A) / Status : Reviewed
Characterization of the oligosaccharide structures on bee venom phospholipase A2. (1993 - Hollander T, Aeed P, Elhammer A) / Status : Reviewed
Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
Structures of sugar chains of the subunits of an alpha-amylase inhibitor from Phaseolus vulgaris white kidney beans. (1992 - Yamaguchi H, Funaoka H, Iwamoto H) / Status : Reviewed
Asparagine-linked oligosaccharides of Semliki Forest virus grown in mosquito cells. (1992 - Naim HY, Koblet H) / Status : Reviewed
Oligosaccharide structures present on asparagine-289 of recombinant human plasminogen expressed in a Chinese hamster ovary cell line. (1991 - Davidson D, Castellino F) / Status : Reviewed
Structures of the asparagine-289-linked oligosaccharides assembled on recombinant human plasminogen expressed in a Mamestra brassicae cell line (IZD-MBO503). (1991 - Davidson D, Castellino F) / Status : Reviewed
Asparagine-linked oligosaccharide processing in lepidopteran insect cells. Temporal dependence of the nature of the oligosaccharides assembled on asparagine-289 of recombinant human plasminogen produced in baculovirus vector infected Spodoptera frugiperda (IPLB-SF-21AE) cells. (1991 - Davidson D, Castellino F) / Status : Reviewed
Isolation of Chinese hamster ovary cell lines producing Man3GlcNAc2 asparagine-linked glycans. (1991 - Zeng Y, Lehrman M) / Status : Reviewed
Different oligosaccharides accumulate in the brain and urine of a cat with alpha-mannosidosis: structure determination of five brain-derived and seventeen urinary oligosaccharides. (1991 - Hard K, Mekking A, Kamerling J, Dacremont G, Vliegenthart J) / Status : Reviewed
The oligosaccharides of influenza virus hemagglutinin expressed in insect cells by a baculovirus vector. (1990 - Kuroda K, Geyer H, Geyer R, Doerfler W, Klenk H) / Status : Reviewed
Carbohydrate structures of quail ovomucoid. Characterization of degraded oligosaccharides produced during alkaline hydrolysis of the asparaginyl-N-acetylglucosamine linkage. (1990 - Alonso J, Boulengueur P, Wieruszeski J, Leroy Y, Montreuil J, Fournet B) / Status : Reviewed
Oligosaccharide processing in the expression of human plasminogen cDNA by lepidopteran insect (Spodoptera frugiperda) cells. (1990 - Davidson D, Fraser M, Castellino F) / Status : Reviewed
Swainsonine induces the production of hybrid glycoproteins and accumulation of oligosaccharides in male reproductive tissues of the rat. (1990 - Tulsiani DR, Skudlarek MD, Orgebin-Crist MC) / Status : Reviewed
Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
Structural studies of the sugar chains of hen ovomucoid. Evidence indicating that they are formed mainly by the alternate biosynthetic pathway of asparagine-linked sugar chains. (1983 - Yamashita K, Kamerling JP, Kobata A) / Status : Reviewed
Preparation and characterisation of fragment glycoasparagines from ovalbumin glycopeptides: reference compounds for structural and biochemical studies of the oligo-mannose and hybrid types of carbohydrate chains of glycoproteins. (1982 - Nomoto H, Endo T, Inoue Y) / Status : Reviewed

Reported glycosite

Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
Beta-secretase / Homo sapiens
- Undefined site
Haptoglobin / Homo sapiens
- Asn-184
Immunoglobulin epsilon chain c region / Homo sapiens
- Asn-275
Latent transforming growth factor beta binding protein 1 / Homo sapiens
- Asn-1366
Prorenin / Homo sapiens
- Undefined site
Prosaposin / Homo sapiens
- Undefined site
Recombinant plasminogen - [r580e] / Homo sapiens
- Undefined site
Recombinant plasminogen - [r580s] / Homo sapiens
- Undefined site
Serotransferrin / Homo sapiens
- Undefined site
Lactotransferrin / Bos taurus
- Asn-252
- Asn-495
Uncharacterized protein from Ovary / Cricetulus griseus
- Undefined site
Uncharacterized protein from Ovary / Cricetulus griseus
- Undefined site
Interferon beta / Mus musculus
- Undefined site
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
T-cell surface glycoprotein cd4 / Rattus norvegicus
- Undefined site
Uncharacterized protein from Epidiymis / Rattus norvegicus
- Undefined site
Uncharacterized protein from Testis / Rattus norvegicus
- Undefined site
Ribonuclease s-6 / Nicotiana alata
- Undefined site
Ovomucoid / Coturnix coturnix
- Undefined site
Ovalbumin / Gallus gallus
- Undefined site
Ovomucoid / Gallus gallus
- Undefined site
Riboflavin-binding protein / Gallus gallus
- Undefined site
Uncharacterized protein from Egg Cell / Gallus gallus
- Undefined site
Uncharacterized protein from Whole Plant / Physomitrella patens
- Undefined site
Uncharacterized protein from Crude Membrane Fraction / Caenorhabditis elegans
- Undefined site
Tsl-1 antigens / Trichinella spiralis
- Undefined site
Uncharacterized protein from Whole Organism / Trichinella spiralis
- Undefined site
Hemocyanin, alpha-d chain / Helix pomatia
- Undefined site
Hemocyanin / Megathura crenulata
- Undefined site
Arylphorin / Antheraea pernyi
- Undefined site
Uncharacterized protein from Hemolymph / Antheraea pernyi
- Undefined site
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
Phospholipase a2 / Apis mellifera
- Asn-46
Membrane glycoproteins / Bombyx mori
- Undefined site
Uncharacterized protein from Undefined tissue / Drosophila melanogaster
- Undefined site
Membrane glycoproteins / Mamestra brassicae
- Undefined site
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
Gp120 / Human immunodeficiency virus
- Undefined site
Peroxidase c1a / Armoracia rusticana
- Undefined site
Diphosphonucleotide phosphatase / phosphodiesterase / Lupinus luteus
- Undefined site
Alpha-amylase inhibitor, chain 2 / Phaseolus vulgaris
- Undefined site
Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)
- Undefined site
Spike glycoprotein e1 / Semliki forest virus
- Undefined site
Spike glycoprotein e2 / Semliki forest virus
- Undefined site

Mass spectrometry observed peptide

CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
- Q14766 Asn-1366

- N-Linked / Pauci-Mannose (avg mass : 910.8325)

Cross-references

GlyTouCan : G22768VO

UniCarb-DB :

Composition

IUPAC

Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc

GlycoCT

RES
1b:b-dglc-HEX-1:5
2s:n-acetyl
3b:b-dglc-HEX-1:5
4s:n-acetyl
5b:b-dman-HEX-1:5
6b:a-dman-HEX-1:5
7b:a-dman-HEX-1:5
LIN
1:1d(2+1)2n
2:1o(4+1)3d
3:3d(2+1)4n
4:3o(4+1)5d
5:5o(3+1)6d
6:5o(6+1)7d