taxonomy (1)
protein (7)
source (2)
structure (1)
composition (1)
disease (0)
reference (2)
site (7)
peptide (4)
- Homo sapiens (Human)
Taxonomy
- IgG1-NK08-V/F genotype / Homo sapiens P01857
- IgG1-NK09-V/F genotype / Homo sapiens P01857
- IgG1-NK11-F/F genotype / Homo sapiens P01857
- IgG1-NK12-V/F genotype / Homo sapiens P01857
- IgG1-NK13-V/F genotype / Homo sapiens P01857
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens P07288
Protein
- N-Linked / Complex / Structure 10977
Reported structure
- Hex:5 HexNAc:5 NeuAc:1 (avg mass : 2135.9602 )
Composition
Disease
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
Reference
- IgG1-NK08-V/F genotype / Homo sapiens
- IgG1-NK09-V/F genotype / Homo sapiens
- IgG1-NK11-F/F genotype / Homo sapiens
- IgG1-NK12-V/F genotype / Homo sapiens
- IgG1-NK13-V/F genotype / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
Reported glycosite
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- AVCGGVLVHPQWVLTAAHCIRNKSVILLGR (30aa)
- NKSVLLGR (8aa)
- TKPREEQYNSTYR (13aa)
- P01857 Asn-180     IgG1-NK12-V/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK11-F/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK13-V/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK09-V/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK08-V/F genotype / Homo sapiens
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 2135.9602)
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- IgG1-NK08-V/F genotype / Homo sapiens
- IgG1-NK09-V/F genotype / Homo sapiens
- IgG1-NK11-F/F genotype / Homo sapiens
- IgG1-NK12-V/F genotype / Homo sapiens
- IgG1-NK13-V/F genotype / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- AVCGGVLVHPQWVLTAAHCIRNKSVILLGR (30aa)
- NKSVLLGR (8aa)
- TKPREEQYNSTYR (13aa)
- P01857 Asn-180     IgG1-NK12-V/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK11-F/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK13-V/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK09-V/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK08-V/F genotype / Homo sapiens
Reference
Reported glycosite
Mass spectrometry observed peptide
3D structure from GLYCAM
- N-Linked / Complex
(avg mass : 2135.9602)