taxonomy (1)
protein (1)
source (5)
structure (48)
composition (69)
disease (3)
reference (8)
site (8)
peptide (14)
- Homo sapiens (Human)
Taxonomy
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Mammary Gland (UBERON_0001911)
- Urine (UBERON_0001088)
Source
- N-Linked / Complex / GlcNAc(?1-?)Man(a1-3)[GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 2643
- N-Linked / Complex / Structure 2011
- N-Linked / Complex / Structure 2719
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 2802
- N-Linked / Complex / Structure 824
- N-Linked / Complex / Structure 231
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 1253
- N-Linked / Complex / Structure 2950
- N-Linked / Complex / Structure 908
- N-Linked / Complex / Structure 3507
- N-Linked / Complex / Structure 32
- N-Linked / Complex / Structure 3125
- N-Linked / Complex / Structure 2489
- N-Linked / Complex / Structure 644
- N-Linked / Complex / Structure 1523
- N-Linked / Complex / Structure 1134
- N-Linked / Complex / Structure 270
- N-Linked / Complex / Structure 923
- N-Linked / Complex / NeuAc(?2-?)Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[NeuAc(?2-?)Gal(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 2607
- N-Linked / Complex / Structure 413
- N-Linked / Complex / Structure 1049
- N-Linked / Complex / Structure 2772
- N-Linked / Complex / Structure 1519
- N-Linked / Complex / Structure 2089
- N-Linked / Complex / Structure 2458
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 1509
- N-Linked / Complex / Structure 2856
- N-Linked / Complex / Structure 1712
- N-Linked / Complex / Structure 439
- N-Linked / Complex / Structure 138
- N-Linked / Complex / Structure 3629
- N-Linked / Complex / Structure 829
- N-Linked / Complex / Structure 3185
- N-Linked / Complex / Structure 1342
- N-Linked / Complex / Structure 3120
- N-Linked / Complex / Structure 2404
- N-Linked / Complex / Structure 2245
- N-Linked / Complex / Structure 3656
- N-Linked / Complex / Structure 788
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Structure 314
- N-Linked / High-Mannose / Structure 2636
Reported structure
- Hex:1 HexNAc:1 NeuAc:1 (avg mass : 674.6106 )
- Hex:1 HexNAc:1 NeuAc:1 NeuGc:1 (avg mass : 981.8679 )
- Hex:1 HexNAc:1 NeuAc:2 (avg mass : 965.8685 )
- Hex:2 HexNAc:2 NeuAc:1 (avg mass : 1039.948 )
- Hex:2 HexNAc:2 NeuAc:2 (avg mass : 1331.2059 )
- Hex:2 HexNAc:2 dHex:2 NeuAc:1 (avg mass : 1332.234 )
- Hex:3 HexNAc:2 dHex:1 (avg mass : 1056.9755 )
- Hex:3 HexNAc:3 NeuAc:2 (avg mass : 1696.5433 )
- Hex:3 HexNAc:3 dHex:2 NeuAc:2 (avg mass : 1988.8293 )
- Hex:3 HexNAc:4 (avg mass : 1317.2225 )
- Hex:3 HexNAc:4 dHex:1 (avg mass : 1463.3655 )
- Hex:3 HexNAc:5 dHex:1 (avg mass : 1666.5605 )
- Hex:3 HexNAc:6 (avg mass : 1723.6125 )
- Hex:4 HexNAc:4 (avg mass : 1479.3649 )
- Hex:4 HexNAc:4 NeuAc:1 (avg mass : 1770.6228 )
- Hex:4 HexNAc:4 dHex:1 (avg mass : 1625.5079 )
- Hex:4 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 1916.7658 )
- Hex:4 HexNAc:5 (avg mass : 1682.5599 )
- Hex:4 HexNAc:5 dHex:1 (avg mass : 1828.7029 )
- Hex:4 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2119.9608 )
- Hex:4 HexNAc:5 dHex:2 (avg mass : 1974.8459 )
- Hex:4 HexNAc:5 dHex:2 NeuAc:1 (avg mass : 2266.1038 )
- Hex:4 HexNAc:6 (avg mass : 1885.7549 )
- Hex:4 HexNAc:6 dHex:2 (avg mass : 2178.0409 )
- Hex:5 HexNAc:2 (avg mass : 1235.1173 )
- Hex:5 HexNAc:4 (avg mass : 1641.5073 )
- Hex:5 HexNAc:4 NeuAc:1 (avg mass : 1932.7652 )
- Hex:5 HexNAc:4 NeuAc:2 (avg mass : 2224.0231 )
- Hex:5 HexNAc:4 dHex:1 (avg mass : 1787.6503 )
- Hex:5 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 2078.9082 )
- Hex:5 HexNAc:4 dHex:1 NeuAc:2 (avg mass : 2370.1661 )
- Hex:5 HexNAc:4 dHex:2 (avg mass : 1933.7933 )
- Hex:5 HexNAc:4 dHex:2 NeuAc:1 (avg mass : 2225.0512 )
- Hex:5 HexNAc:5 (avg mass : 1844.7023 )
- Hex:5 HexNAc:5 dHex:1 (avg mass : 1990.8453 )
- Hex:5 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2282.1032 )
- Hex:5 HexNAc:5 dHex:1 NeuAc:2 (avg mass : 2573.3611 )
- Hex:5 HexNAc:5 dHex:2 (avg mass : 2136.9883 )
- Hex:5 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2485.2982 )
- Hex:5 HexNAc:6 dHex:1 NeuAc:2 (avg mass : 2776.5561 )
- Hex:6 HexNAc:2 (avg mass : 1397.2597 )
- Hex:6 HexNAc:3 NeuAc:1 (avg mass : 1891.7126 )
- Hex:6 HexNAc:3 dHex:1 (avg mass : 1746.5977 )
- Hex:6 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 2241.0506 )
- Hex:6 HexNAc:4 dHex:2 NeuAc:1 (avg mass : 2387.1936 )
- Hex:6 HexNAc:5 (avg mass : 2006.8447 )
- Hex:6 HexNAc:5 NeuAc:1 (avg mass : 2298.1026 )
- Hex:6 HexNAc:5 NeuAc:2 (avg mass : 2589.3605 )
- Hex:6 HexNAc:5 NeuAc:3 (avg mass : 2880.6184 )
- Hex:6 HexNAc:5 dHex:1 (avg mass : 2152.9877 )
- Hex:6 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2444.2456 )
- Hex:6 HexNAc:5 dHex:1 NeuAc:2 (avg mass : 2735.5035 )
- Hex:6 HexNAc:5 dHex:1 NeuAc:3 (avg mass : 3026.7614 )
- Hex:6 HexNAc:5 dHex:2 NeuAc:1 (avg mass : 2590.3886 )
- Hex:6 HexNAc:5 dHex:2 NeuAc:3 (avg mass : 3172.9044 )
- Hex:6 HexNAc:5 dHex:4 NeuAc:1 (avg mass : 2882.6746 )
- Hex:6 HexNAc:6 (avg mass : 2210.0397 )
- Hex:7 HexNAc:2 (avg mass : 1559.4021 )
- Hex:7 HexNAc:5 dHex:1 NeuAc:2 (avg mass : 2897.6459 )
- Hex:7 HexNAc:6 NeuAc:2 (avg mass : 2954.6979 )
- Hex:7 HexNAc:6 NeuAc:3 (avg mass : 3245.9558 )
- Hex:7 HexNAc:6 dHex:1 (avg mass : 2518.3251 )
- Hex:7 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2809.583 )
- Hex:7 HexNAc:6 dHex:1 NeuAc:2 (avg mass : 3100.8409 )
- Hex:7 HexNAc:6 dHex:1 NeuAc:3 (avg mass : 3392.0988 )
- Hex:7 HexNAc:6 dHex:1 NeuAc:4 (avg mass : 3683.3567 )
- Hex:7 HexNAc:6 dHex:2 NeuAc:2 (avg mass : 3246.9839 )
- Hex:8 HexNAc:2 (avg mass : 1721.5445 )
- Hex:12 HexNAc:2 (avg mass : 2370.1141 )
Composition
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Computational framework for identification of intact glycopeptides in complex samples (2014 - Mayampurath A, Yu CY, Song E, Balan J, Mechref Y, Tang H.) / Status : Reviewed
Reference
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
Reported glycosite
- KAFITNFSMIIDGMTYPGIIK (21aa)
- AFITNF (6aa)
- AFITNFSMNIDGMTYPGIIK (20aa)
- AFITNFSMIIDGMTYPGIIK (20aa)
- MTNQLVDALTTWQNK (15aa)
- TNQLVDALTTWQNK (14aa)
- GPDVLTATVSGKLPTQNITFQTESSVAEQEAEFQSPK (37aa)
- LQDRGPDVLTATVSGKLPTQNITFQTESSVAEQEAEFQSPK (41aa)
- LPTQNITFQTESSVAEQEAEFQSPK (25aa)
- IPTQNITFQTESSVAEQEAEFQSPK (25aa)
- NQALNLSLAYSFVTPLTSMVVTK (23aa)
- NQALNLSLAY (10aa)
- LAILPASATPATSNPDPAVSR (21aa)
- IEETTMTTQTPAPIQAPSAILPLPGQSVER (30aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 1317.2225)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1463.3655)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1625.5079)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1641.5073)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1682.5599)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1770.6228)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1787.6503)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1828.7029)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1844.7023)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1916.7658)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1932.7652)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1933.7933)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1974.8459)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1990.8453)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2006.8447)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2078.9082)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2119.9608)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2136.9883)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2152.9877)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2224.0231)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Esophageal cancer (DOID:5041)
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Computational framework for identification of intact glycopeptides in complex samples (2014 - Mayampurath A, Yu CY, Song E, Balan J, Mechref Y, Tang H.) / Status : Reviewed
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2225.0512)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2266.1038)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2282.1032)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2298.1026)
- Blood Serum (UBERON_0001977)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2370.1661)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2444.2456)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2485.2982)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2518.3251)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2573.3611)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2590.3886)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2735.5035)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2776.5561)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2809.583)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Blood Serum (UBERON_0001977)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2954.6979)
- Blood Serum (UBERON_0001977)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 3026.7614)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 3100.8409)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 3172.9044)
- Blood Serum (UBERON_0001977)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 3245.9558)
- Blood Serum (UBERON_0001977)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 3246.9839)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 3392.0988)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 3683.3567)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / High-Mannose
(avg mass : 1235.1173)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / High-Mannose
(avg mass : 1397.2597)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / High-Mannose
(avg mass : 1559.4021)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / High-Mannose
(avg mass : 1721.5445)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- Hex:3 HexNAc:6 / N-Linked
(avg mass : 1723.6125)
- Mammary Gland (UBERON_0001911)
- Cancer, breast (DOID:1612)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- AFITNF (6aa)
-
- Hex:6 HexNAc:3 dHex:1 / N-Linked
(avg mass : 1746.5977)
- Mammary Gland (UBERON_0001911)
- Cancer, breast (DOID:1612)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- AFITNF (6aa)
-
- Hex:6 HexNAc:3 NeuAc:1 / N-Linked
(avg mass : 1891.7126)
- Blood Serum (UBERON_0001977)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- KAFITNFSMIIDGMTYPGIIK (21aa)
-
- Hex:5 HexNAc:4 NeuAc:1 / N-Linked
(avg mass : 1932.7652)
- N-Linked / Complex / Structure 3507
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- AFITNFSMNIDGMTYPGIIK (20aa)
- AFITNFSMIIDGMTYPGIIK (20aa)
- LPTQNITFQTESSVAEQEAEFQSPK (25aa)
- IPTQNITFQTESSVAEQEAEFQSPK (25aa)
-
- Hex:5 HexNAc:4 dHex:1 NeuAc:1 / N-Linked
(avg mass : 2078.9082)
- Mammary Gland (UBERON_0001911)
- N-Linked / Complex / Structure 1523
- Cancer, breast (DOID:1612)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- GPDVLTATVSGKLPTQNITFQTESSVAEQEAEFQSPK (37aa)
-
- Hex:4 HexNAc:6 dHex:2 / N-Linked
(avg mass : 2178.0409)
- Mammary Gland (UBERON_0001911)
- Cancer, breast (DOID:1612)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- AFITNFSMNIDGMTYPGIIK (20aa)
- AFITNFSMIIDGMTYPGIIK (20aa)
- IPTQNITFQTESSVAEQEAEFQSPK (25aa)
-
- Hex:6 HexNAc:6 / N-Linked
(avg mass : 2210.0397)
- Mammary Gland (UBERON_0001911)
- Cancer, breast (DOID:1612)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- AFITNF (6aa)
-
- Hex:5 HexNAc:4 NeuAc:2 / N-Linked
(avg mass : 2224.0231)
- N-Linked / Complex / NeuAc(?2-?)Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[NeuAc(?2-?)Gal(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- AFITNF (6aa)
- AFITNFSMNIDGMTYPGIIK (20aa)
- AFITNFSMIIDGMTYPGIIK (20aa)
- MTNQLVDALTTWQNK (15aa)
- TNQLVDALTTWQNK (14aa)
- LQDRGPDVLTATVSGKLPTQNITFQTESSVAEQEAEFQSPK (41aa)
- GPDVLTATVSGKLPTQNITFQTESSVAEQEAEFQSPK (37aa)
- LPTQNITFQTESSVAEQEAEFQSPK (25aa)
- IPTQNITFQTESSVAEQEAEFQSPK (25aa)
- NQALNLSLAY (10aa)
-
- Hex:5 HexNAc:4 dHex:2 NeuAc:1 / N-Linked
(avg mass : 2225.0512)
- N-Linked / Complex / Structure 2607
- Prostate cancer (DOID:10283)
- Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- AFITNFSMIIDGMTYPGIIK (20aa)
- LPTQNITFQTESSVAEQEAEFQSPK (25aa)
-
- Hex:6 HexNAc:4 dHex:1 NeuAc:1 / N-Linked
(avg mass : 2241.0506)
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- AFITNF (6aa)
- AFITNFSMNIDGMTYPGIIK (20aa)
- AFITNFSMIIDGMTYPGIIK (20aa)
- GPDVLTATVSGKLPTQNITFQTESSVAEQEAEFQSPK (37aa)
- LPTQNITFQTESSVAEQEAEFQSPK (25aa)
- IPTQNITFQTESSVAEQEAEFQSPK (25aa)
-
- Hex:12 HexNAc:2 / N-Linked
(avg mass : 2370.1141)
- Mammary Gland (UBERON_0001911)
- Cancer, breast (DOID:1612)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- AFITNFSMIIDGMTYPGIIK (20aa)
- GPDVLTATVSGKLPTQNITFQTESSVAEQEAEFQSPK (37aa)
- IPTQNITFQTESSVAEQEAEFQSPK (25aa)
-
- Hex:5 HexNAc:4 dHex:1 NeuAc:2 / N-Linked
(avg mass : 2370.1661)
- Blood Serum (UBERON_0001977)
- N-Linked / Complex / Structure 1519
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- LPTQNITFQTESSVAEQEAEFQSPK (25aa)
-
- Hex:6 HexNAc:4 dHex:2 NeuAc:1 / N-Linked
(avg mass : 2387.1936)
- Blood Serum (UBERON_0001977)
- Prostate cancer (DOID:10283)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- AFITNFSMIIDGMTYPGIIK (20aa)
-
- Hex:6 HexNAc:5 NeuAc:2 / N-Linked
(avg mass : 2589.3605)
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- AFITNFSMIIDGMTYPGIIK (20aa)
- LPTQNITFQTESSVAEQEAEFQSPK (25aa)
- IPTQNITFQTESSVAEQEAEFQSPK (25aa)
- NQALNLSLAYSFVTPLTSMVVTK (23aa)
-
- Hex:6 HexNAc:5 dHex:1 NeuAc:2 / N-Linked
(avg mass : 2735.5035)
- Blood Serum (UBERON_0001977)
- N-Linked / Complex / Structure 1712
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- LPTQNITFQTESSVAEQEAEFQSPK (25aa)
-
- Hex:6 HexNAc:5 NeuAc:3 / N-Linked
(avg mass : 2880.6184)
- N-Linked / Complex / Structure 3629
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- AFITNFSMIIDGMTYPGIIK (20aa)
- GPDVLTATVSGKLPTQNITFQTESSVAEQEAEFQSPK (37aa)
- LPTQNITFQTESSVAEQEAEFQSPK (25aa)
- NQALNLSLAYSFVTPLTSMVVTK (23aa)
- NQALNLSLAY (10aa)
-
- Hex:6 HexNAc:5 dHex:4 NeuAc:1 / N-Linked
(avg mass : 2882.6746)
- Blood Serum (UBERON_0001977)
- Prostate cancer (DOID:10283)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- LPTQNITFQTESSVAEQEAEFQSPK (25aa)
-
- Hex:7 HexNAc:5 dHex:1 NeuAc:2 / N-Linked
(avg mass : 2897.6459)
- Mammary Gland (UBERON_0001911)
- Cancer, breast (DOID:1612)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- IPTQNITFQTESSVAEQEAEFQSPK (25aa)
-
- Hex:6 HexNAc:5 dHex:1 NeuAc:3 / N-Linked
(avg mass : 3026.7614)
- N-Linked / Complex / Structure 3185
- Cancer, breast (DOID:1612)
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- LPTQNITFQTESSVAEQEAEFQSPK (25aa)
- IPTQNITFQTESSVAEQEAEFQSPK (25aa)
-
- Hex:1 HexNAc:1 NeuAc:1 / O-Linked
(avg mass : 674.6106)
- Urine (UBERON_0001088)
- Prostate cancer (DOID:10283)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- IEETTMTTQTPAPIQAPSAILPLPGQSVER (30aa)
-
- Hex:1 HexNAc:1 NeuAc:2 / O-Linked
(avg mass : 965.8685)
- Urine (UBERON_0001088)
- Prostate cancer (DOID:10283)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- IEETTMTTQTPAPIQAPSAILPLPGQSVER (30aa)
-
- Hex:1 HexNAc:1 NeuAc:1 NeuGc:1 / O-Linked
(avg mass : 981.8679)
- Urine (UBERON_0001088)
- Prostate cancer (DOID:10283)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- IEETTMTTQTPAPIQAPSAILPLPGQSVER (30aa)
-
- Hex:2 HexNAc:2 NeuAc:1 / O-Linked
(avg mass : 1039.948)
- Urine (UBERON_0001088)
- Prostate cancer (DOID:10283)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- IEETTMTTQTPAPIQAPSAILPLPGQSVER (30aa)
-
- Hex:3 HexNAc:2 dHex:1 / O-Linked
(avg mass : 1056.9755)
- Urine (UBERON_0001088)
- Prostate cancer (DOID:10283)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- IEETTMTTQTPAPIQAPSAILPLPGQSVER (30aa)
-
- Hex:2 HexNAc:2 NeuAc:2 / O-Linked
(avg mass : 1331.2059)
- Prostate cancer (DOID:10283)
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- IEETTMTTQTPAPIQAPSAILPLPGQSVER (30aa)
-
- Hex:2 HexNAc:2 dHex:2 NeuAc:1 / O-Linked
(avg mass : 1332.234)
- Urine (UBERON_0001088)
- Prostate cancer (DOID:10283)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- IEETTMTTQTPAPIQAPSAILPLPGQSVER (30aa)
-
- Hex:3 HexNAc:3 NeuAc:2 / O-Linked
(avg mass : 1696.5433)
- Urine (UBERON_0001088)
- Prostate cancer (DOID:10283)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- IEETTMTTQTPAPIQAPSAILPLPGQSVER (30aa)
-
- Hex:4 HexNAc:6 / O-Linked
(avg mass : 1885.7549)
- Urine (UBERON_0001088)
- Prostate cancer (DOID:10283)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- IEETTMTTQTPAPIQAPSAILPLPGQSVER (30aa)
-
- Hex:3 HexNAc:3 dHex:2 NeuAc:2 / O-Linked
(avg mass : 1988.8293)
- Urine (UBERON_0001088)
- Prostate cancer (DOID:10283)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- LAILPASATPATSNPDPAVSR (21aa)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:3 HexNAc:3 dHex:2 NeuAc:2 / O-Linked
(avg mass : 1988.8293)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:4 HexNAc:6 / O-Linked
(avg mass : 1885.7549)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:3 HexNAc:3 NeuAc:2 / O-Linked
(avg mass : 1696.5433)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:2 HexNAc:2 dHex:2 NeuAc:1 / O-Linked
(avg mass : 1332.234)
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:2 HexNAc:2 NeuAc:2 / O-Linked
(avg mass : 1331.2059)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:3 HexNAc:2 dHex:1 / O-Linked
(avg mass : 1056.9755)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:2 HexNAc:2 NeuAc:1 / O-Linked
(avg mass : 1039.948)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:1 HexNAc:1 NeuAc:1 NeuGc:1 / O-Linked
(avg mass : 981.8679)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:1 HexNAc:1 NeuAc:2 / O-Linked
(avg mass : 965.8685)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:1 HexNAc:1 NeuAc:1 / O-Linked
(avg mass : 674.6106)
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:6 HexNAc:5 dHex:1 NeuAc:3 / N-Linked
(avg mass : 3026.7614)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:7 HexNAc:5 dHex:1 NeuAc:2 / N-Linked
(avg mass : 2897.6459)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:6 HexNAc:5 dHex:4 NeuAc:1 / N-Linked
(avg mass : 2882.6746)
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:6 HexNAc:5 NeuAc:3 / N-Linked
(avg mass : 2880.6184)
Source
Suggested structure
Reported glycosite
Mass spectrometry observed peptide
- Hex:6 HexNAc:5 dHex:1 NeuAc:2 / N-Linked
(avg mass : 2735.5035)
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:6 HexNAc:5 NeuAc:2 / N-Linked
(avg mass : 2589.3605)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:6 HexNAc:4 dHex:2 NeuAc:1 / N-Linked
(avg mass : 2387.1936)
Source
Suggested structure
Reported glycosite
Mass spectrometry observed peptide
- Hex:5 HexNAc:4 dHex:1 NeuAc:2 / N-Linked
(avg mass : 2370.1661)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:12 HexNAc:2 / N-Linked
(avg mass : 2370.1141)
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:6 HexNAc:4 dHex:1 NeuAc:1 / N-Linked
(avg mass : 2241.0506)
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:5 HexNAc:4 dHex:2 NeuAc:1 / N-Linked
(avg mass : 2225.0512)
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:5 HexNAc:4 NeuAc:2 / N-Linked
(avg mass : 2224.0231)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:6 HexNAc:6 / N-Linked
(avg mass : 2210.0397)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:4 HexNAc:6 dHex:2 / N-Linked
(avg mass : 2178.0409)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:5 HexNAc:4 dHex:1 NeuAc:1 / N-Linked
(avg mass : 2078.9082)
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:5 HexNAc:4 NeuAc:1 / N-Linked
(avg mass : 1932.7652)
Source
Suggested structure
Reported glycosite
Mass spectrometry observed peptide
- Hex:6 HexNAc:3 NeuAc:1 / N-Linked
(avg mass : 1891.7126)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:6 HexNAc:3 dHex:1 / N-Linked
(avg mass : 1746.5977)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- Hex:3 HexNAc:6 / N-Linked
(avg mass : 1723.6125)
Source
Reported glycosite
Suggested glycosite
- N-Linked / High-Mannose
(avg mass : 1721.5445)
Source
Reported glycosite
Suggested glycosite
- N-Linked / High-Mannose
(avg mass : 1559.4021)
Reported glycosite
Suggested glycosite
- N-Linked / High-Mannose
(avg mass : 1397.2597)
Reported glycosite
Suggested glycosite
- N-Linked / High-Mannose
(avg mass : 1235.1173)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 3683.3567)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 3392.0988)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 3246.9839)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 3245.9558)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 3172.9044)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 3100.8409)
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 3026.7614)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2954.6979)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2809.583)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2776.5561)
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2590.3886)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2573.3611)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2518.3251)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2485.2982)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2444.2456)
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2370.1661)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2298.1026)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2282.1032)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2266.1038)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2225.0512)
Source
Disease
Reference
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2224.0231)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2152.9877)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2136.9883)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2119.9608)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2078.9082)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2006.8447)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1990.8453)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1974.8459)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1933.7933)
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1932.7652)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1844.7023)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1828.7029)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1787.6503)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1770.6228)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1682.5599)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1641.5073)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1625.5079)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1479.3649)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1463.3655)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1317.2225)