GlyConnect

Site	Core / Type	Cartoon	Composition	Biological associations
Asn-264	N-Linked / Undefined core		Hex:6 HexNAc:5 NeuAc:3	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (0) reference (1) site (1) peptide (2) Taxonomy Homo sapiens (Human) Protein Attractin / Homo sapiens O75882 Source Blood Serum (UBERON_0001977) Reported structure Composition Hex:6 HexNAc:5 NeuAc:3 (avg mass : 2880.6184 ) Disease Reference Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed Reported glycosite Attractin / Homo sapiens Asn-264 Mass spectrometry observed peptide ISNSSDTVECECSENWK (17aa) O75882 Asn-264 ISNSSDTVECECSENWKGEACDIPHCTDNCGFPHR (35aa) O75882 Asn-264
Asn-264	N-Linked / Undefined core		Hex:5 HexNAc:4 NeuAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (0) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Attractin / Homo sapiens O75882 Source Blood Serum (UBERON_0001977) Reported structure Composition Hex:5 HexNAc:4 NeuAc:2 (avg mass : 2224.0231 ) Disease Reference Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed Reported glycosite Attractin / Homo sapiens Asn-264 Mass spectrometry observed peptide ISNSSDTVECECSENWK (17aa) O75882 Asn-264
Asn-264	N-Linked / Undefined core		Hex:4 HexNAc:6	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Attractin / Homo sapiens O75882 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:4 HexNAc:6 (avg mass : 1885.7549 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Attractin / Homo sapiens Asn-264 Mass spectrometry observed peptide ISNSSDTVECECSENWK (17aa) O75882 Asn-264
Asn-264	N-Linked / Undefined core		Hex:3 HexNAc:4 NeuAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Attractin / Homo sapiens O75882 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:3 HexNAc:4 NeuAc:2 (avg mass : 1899.7383 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Attractin / Homo sapiens Asn-264 Mass spectrometry observed peptide ISNSSDTVECECSENWK (17aa) O75882 Asn-264

← Previous
Displaying 1 to 4 of 4
Next →

Show all