GlyConnect

Site	Core / Type	Composition	Biological associations
Asn-158	N-Linked / Undefined core	Hex:5 HexNAc:4 NeuAc:2	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (2) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-158 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK (33aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK (33aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696
Asn-158	N-Linked / Undefined core	Hex:5 HexNAc:4 dHex:1 NeuAc:1	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-158 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696
Asn-158	N-Linked / Undefined core	Hex:5 HexNAc:5 NeuAc:1	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-158 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696
Asn-158	N-Linked / Undefined core	Hex:12 HexNAc:2	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (2) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-158 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK (33aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK (33aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696
Asn-158	N-Linked / Undefined core	Hex:4 HexNAc:4 NeuAc:1	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-158 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696
Asn-158	N-Linked / Undefined core	Hex:5 HexNAc:4	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-158 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696
Asn-158	N-Linked / Undefined core	Hex:4 HexNAc:4 dHex:2	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-158 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696
Asn-158	N-Linked / Undefined core	Hex:6 HexNAc:4 NeuAc:1	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-158 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696
Asn-158	N-Linked / Undefined core	Hex:5 HexNAc:4 dHex:1 NeuAc:2	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-158 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696
Asn-158	N-Linked / Undefined core	Hex:5 HexNAc:4 dHex:2 NeuAc:1	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (2) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-158 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK (33aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK (33aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696
Asn-158	N-Linked / Undefined core	Hex:6 HexNAc:5 NeuAc:3	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-158 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696
Asn-158	N-Linked / Undefined core	Hex:6 HexNAc:5	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-158 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696
Asn-158	N-Linked / Undefined core	Hex:5 HexNAc:4 NeuAc:1	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (2) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-158 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK (33aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK (33aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696
Asn-158	N-Linked / Undefined core	Hex:5 HexNAc:5 dHex:1 NeuAc:2	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-158 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696
Asn-158	N-Linked / Undefined core	Hex:6 HexNAc:4 dHex:1 NeuAc:1	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-158 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696
Asn-158	N-Linked / Undefined core	Hex:6 HexNAc:5 NeuAc:1	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (2) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-158 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK (33aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK (33aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696
Asn-158	N-Linked / Undefined core	Hex:6 HexNAc:6	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-158 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK (33aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK (33aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696
Asn-158	N-Linked / Undefined core	Hex:5 HexNAc:6 dHex:1	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (2) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-158 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK (33aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK (33aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696
Asn-158	N-Linked / Undefined core	Hex:4 HexNAc:6 dHex:1	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-158 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696
Asn-158	N-Linked / Undefined core	Hex:4 HexNAc:9	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-158 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696
Asn-158	N-Linked / Undefined core	Hex:6 HexNAc:5 NeuAc:2	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-158 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696
Asn-432	N-Linked / Undefined core	Hex:5 HexNAc:4 NeuAc:2	Tissue (3) Disease (2) Reference (3) Site (1) Peptide (8) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Urogenital System > Excretion > Urine Hemic System > Plasma > Serum Disease Cancer, breast Prostate cancer Reference Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-432 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK (33aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK (33aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696 CGIVPVIAENYNK (13aa) P02787 Asn-432 LAENYNK (7aa) P02787 Asn-432 KCGLVPVLAENYNK (14aa) P02787 Asn-432 GLVPVLAENYNK (12aa) P02787 Asn-432 CGLVPVLAENYNKSDNCEDTPEAGYF (26aa) P02787 Asn-432 CGLVPVLAENYNK (13aa) P02787 Asn-432
Asn-432	N-Linked / Undefined core	Hex:5 HexNAc:4 dHex:1 NeuAc:1	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (2) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-432 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696 CGIVPVIAENYNK (13aa) P02787 Asn-432
Asn-432	N-Linked / Undefined core	Hex:5 HexNAc:5 NeuAc:1	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-432 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696
Asn-432	N-Linked / Undefined core	Hex:12 HexNAc:2	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (4) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-432 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK (33aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK (33aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696 CGIVPVIAENYNK (13aa) P02787 Asn-432 KCGLVPVLAENYNK (14aa) P02787 Asn-432
Asn-432	N-Linked / Complex	Hex:5 HexNAc:4 NeuAc:2	Tissue (1) Disease (0) Reference (1) Site (1) Peptide (0) Tissue Hemic System > Plasma Disease Reference N-glycosylation site mapping of human serotransferrin by serial lectin affinity chromatography, fast atom bombardment-mass spectrometry, and 1H nuclear magnetic resonance spectroscopy. (1992 - Fu D, van Halbeek H) / Status : Reviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-432 (1 structure) Mass spectrometry validated peptide
Asn-432	N-Linked / Undefined core	Hex:4 HexNAc:4 NeuAc:1	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-432 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696
Asn-432	N-Linked / Undefined core	Hex:5 HexNAc:4	Tissue (2) Disease (1) Reference (2) Site (1) Peptide (3) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Hemic System > Plasma > Serum Disease Cancer, breast Reference Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-432 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696 CGIVPVIAENYNK (13aa) P02787 Asn-432 CGLVPVLAENYNK (13aa) P02787 Asn-432
Asn-432	N-Linked / Complex	Hex:6 HexNAc:5 NeuAc:3	Tissue (1) Disease (0) Reference (1) Site (1) Peptide (0) Tissue Hemic System > Plasma Disease Reference N-glycosylation site mapping of human serotransferrin by serial lectin affinity chromatography, fast atom bombardment-mass spectrometry, and 1H nuclear magnetic resonance spectroscopy. (1992 - Fu D, van Halbeek H) / Status : Reviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-432 (1 structure) Mass spectrometry validated peptide
Asn-432	N-Linked / Undefined core	Hex:4 HexNAc:4 dHex:2	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-432 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696
Asn-432	N-Linked / Undefined core	Hex:6 HexNAc:4 NeuAc:1	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (2) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-432 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696 CGIVPVIAENYNK (13aa) P02787 Asn-432
Asn-432	N-Linked / Complex	Hex:6 HexNAc:5 NeuAc:3	Tissue (1) Disease (0) Reference (1) Site (1) Peptide (0) Tissue Hemic System > Plasma Disease Reference N-glycosylation site mapping of human serotransferrin by serial lectin affinity chromatography, fast atom bombardment-mass spectrometry, and 1H nuclear magnetic resonance spectroscopy. (1992 - Fu D, van Halbeek H) / Status : Reviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-432 (1 structure) Mass spectrometry validated peptide
Asn-432	N-Linked / Complex	Hex:4 HexNAc:4	Tissue (1) Disease (0) Reference (1) Site (1) Peptide (0) Tissue Nervous System > Cerebrospinal Fluid Disease Reference Enrichment of glycopeptides for glycan structure and attachment site identification (2009 - Nilsson J, Rüetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G.) / Status : Reviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-432 (1 structure) Mass spectrometry validated peptide
Asn-432	N-Linked / Undefined core	Hex:5 HexNAc:4 dHex:1 NeuAc:2	Tissue (2) Disease (1) Reference (2) Site (1) Peptide (2) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Hemic System > Plasma > Serum Disease Cancer, breast Reference Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-432 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNK (13aa) P02787 Asn-432
Asn-432	N-Linked / Undefined core	Hex:6 HexNAc:5 dHex:1 NeuAc:2	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-432 (1 structure) Mass spectrometry validated peptide CGIVPVIAENYNK (13aa) P02787 Asn-432
Asn-432	N-Linked / Undefined core	Hex:5 HexNAc:4 dHex:2 NeuAc:1	Tissue (2) Disease (2) Reference (2) Site (1) Peptide (4) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Urogenital System > Excretion > Urine Disease Cancer, breast Prostate cancer Reference Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-432 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK (33aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK (33aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696 CGIVPVIAENYNK (13aa) P02787 Asn-432 CGLVPVLAENYNK (13aa) P02787 Asn-432
Asn-432	N-Linked / Undefined core	Hex:6 HexNAc:5 NeuAc:3	Tissue (2) Disease (1) Reference (2) Site (1) Peptide (3) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Hemic System > Plasma > Serum Disease Cancer, breast Reference Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-432 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696 CGIVPVIAENYNK (13aa) P02787 Asn-432 CGLVPVLAENYNK (13aa) P02787 Asn-432
Asn-432	N-Linked / Undefined core	Hex:4 HexNAc:4 dHex:1 NeuAc:1	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-432 (1 structure) Mass spectrometry validated peptide CGIVPVIAENYNK (13aa) P02787 Asn-432
Asn-432	N-Linked / Complex	Hex:5 HexNAc:4	Tissue (1) Disease (0) Reference (1) Site (1) Peptide (0) Tissue Nervous System > Cerebrospinal Fluid Disease Reference Enrichment of glycopeptides for glycan structure and attachment site identification (2009 - Nilsson J, Rüetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G.) / Status : Reviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-432 (1 structure) Mass spectrometry validated peptide
Asn-432	N-Linked / Undefined core	Hex:6 HexNAc:5	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (2) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-432 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696 CGIVPVIAENYNK (13aa) P02787 Asn-432
Asn-432	N-Linked / Undefined core	Hex:6 HexNAc:4 dHex:1	Tissue (2) Disease (2) Reference (2) Site (1) Peptide (2) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Urogenital System > Excretion > Urine Disease Cancer, breast Prostate cancer Reference Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-432 (1 structure) Mass spectrometry validated peptide CGIVPVIAENYNK (13aa) P02787 Asn-432 CGLVPVLAENYNK (13aa) P02787 Asn-432
Asn-432	N-Linked / Undefined core	Hex:5 HexNAc:4 NeuAc:1	Tissue (3) Disease (2) Reference (3) Site (1) Peptide (5) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Urogenital System > Excretion > Urine Hemic System > Plasma > Serum Disease Cancer, breast Prostate cancer Reference Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-432 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK (33aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK (33aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696 CGIVPVIAENYNK (13aa) P02787 Asn-432 KCGLVPVLAENYNK (14aa) P02787 Asn-432 CGLVPVLAENYNK (13aa) P02787 Asn-432
Asn-432	N-Linked / Undefined core	Hex:5 HexNAc:5 dHex:1 NeuAc:2	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-432 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696
Asn-432	N-Linked / Undefined core	Hex:6 HexNAc:4 dHex:1 NeuAc:1	Tissue (2) Disease (2) Reference (2) Site (1) Peptide (3) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Urogenital System > Excretion > Urine Disease Cancer, breast Prostate cancer Reference Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-432 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696 CGIVPVIAENYNK (13aa) P02787 Asn-432 CGLVPVLAENYNK (13aa) P02787 Asn-432
Asn-432	N-Linked / Complex	Hex:6 HexNAc:5	Tissue (1) Disease (0) Reference (1) Site (1) Peptide (0) Tissue Nervous System > Cerebrospinal Fluid Disease Reference Enrichment of glycopeptides for glycan structure and attachment site identification (2009 - Nilsson J, Rüetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G.) / Status : Reviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-432 (1 structure) Mass spectrometry validated peptide
Asn-432	N-Linked / Undefined core	Hex:6 HexNAc:4 dHex:2	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-432 (1 structure) Mass spectrometry validated peptide CGIVPVIAENYNK (13aa) P02787 Asn-432
Asn-432	N-Linked / Undefined core	Hex:6 HexNAc:5 NeuAc:1	Tissue (2) Disease (1) Reference (2) Site (1) Peptide (4) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Hemic System > Plasma > Serum Disease Cancer, breast Reference Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-432 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK (33aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK (33aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696 CGIVPVIAENYNK (13aa) P02787 Asn-432 CGLVPVLAENYNK (13aa) P02787 Asn-432
Asn-432	N-Linked / Undefined core	Hex:6 HexNAc:6	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-432 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK (33aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK (33aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696
Asn-432	N-Linked / Undefined core	Hex:5 HexNAc:6 dHex:1	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (3) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-432 (1 structure) Mass spectrometry validated peptide CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK (33aa) P02787 Asn-432 VAR_058199 448:I→V dbSNP:rs2692696 CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK (33aa) P02787 Asn-158 VAR_058199 448:I→V dbSNP:rs2692696 CGIVPVIAENYNK (13aa) P02787 Asn-432
Asn-432	N-Linked / Undefined core	Hex:4 HexNAc:6 dHex:2	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (2) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serotransferrin / Homo sapiens : Asn-432 (1 structure) Mass spectrometry validated peptide CGIVPVIAENYNK (13aa) P02787 Asn-432 KCGLVPVLAENYNK (14aa) P02787 Asn-432

← Previous
Displaying 1 to 50 of 153
Next →

Show all

Serotransferrin (Homo sapiens)

All glycosylation sites

Tissue

Disease

Reference

Reported glycosite

Mass spectrometry validated peptide

Tissue

Disease

Reference

Reported glycosite

Mass spectrometry validated peptide

Tissue

Disease

Reference

Reported glycosite

Mass spectrometry validated peptide

Tissue

Disease

Reference

Reported glycosite

Mass spectrometry validated peptide

Tissue

Disease

Reference

Reported glycosite

Mass spectrometry validated peptide

Tissue

Disease

Reference

Reported glycosite

Mass spectrometry validated peptide

Tissue

Disease

Reference

Reported glycosite

Mass spectrometry validated peptide

Tissue

Disease

Reference

Reported glycosite

Mass spectrometry validated peptide

Tissue

Disease

Reference

Reported glycosite

Mass spectrometry validated peptide

Tissue

Disease

Reference

Reported glycosite

Mass spectrometry validated peptide

Tissue

Disease

Reference

Reported glycosite

Mass spectrometry validated peptide

Tissue

Disease

Reference

Reported glycosite

Mass spectrometry validated peptide

Tissue

Disease

Reference

Reported glycosite

Mass spectrometry validated peptide

Tissue

Disease

Reference

Reported glycosite

Mass spectrometry validated peptide

Tissue

Disease

Reference

Reported glycosite

Mass spectrometry validated peptide

Tissue

Disease

Reference