taxonomy (1)
protein (1)
source (8)
structure (87)
composition (67)
disease (6)
reference (22)
site (5)
peptide (23)
- Homo sapiens (Human)
Taxonomy
- Serotransferrin / Homo sapiens P02787
Protein
- Amniotic Fluid (UBERON_0000173)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Urine (UBERON_0001088)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- Cerebrospinal Fluid Secretion (GO_0033326)
Source
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 2011
- N-Linked / Complex / NeuAc(?2-?)Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)][Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 10712
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Fuc(?1-?)[Gal(?1-?)]GlcNAc(?1-?)Man(a1-?)[Gal(?1-?)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 3041
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 3507
- N-Linked / Complex / Structure 10835
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 644
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Man(a1-?)[Gal(?1-?)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 1523
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10742
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Man(a1-?)[Gal(?1-?)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / Structure 9463
- N-Linked / Complex / NeuAc(?2-?)Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[NeuAc(?2-?)Gal(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 10794
- N-Linked / Complex / Structure 10795
- N-Linked / Complex / Structure 9425
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Man(a1-?)[Gal(?1-?)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ NeuAc(a2-6)"
- N-Linked / Complex / Structure 9470
- N-Linked / Complex / Structure 10700
- N-Linked / Complex / Neu?c(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Neu?c(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / NeuAc(?2-?)Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[NeuAc(?2-?)Gal(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10694
- N-Linked / Complex / Structure 10705
- N-Linked / Complex / Structure 10706
- N-Linked / Complex / Structure 10786
- N-Linked / Complex / Structure 10725
- N-Linked / Complex / Structure 10785
- N-Linked / Complex / Structure 9462
- N-Linked / Complex / Structure 10693
- N-Linked / Complex / Structure 10737
- N-Linked / Complex / Structure 10752
- N-Linked / Complex / Structure 10799
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 10791
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-4)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10805
- N-Linked / Complex / Structure 10708
- N-Linked / Complex / Structure 10734
- N-Linked / Complex / Structure 10775
- N-Linked / Complex / Structure 10689
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)[Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / No-core / Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)][Fuc(a1-6)]GlcNAc
- N-Linked / Undefined core / NeuAc(??-?)Hex(??-?)HexNAc(??-?)Hex(??-?)[NeuAc(??-?)Hex(??-?)HexNAc(??-?)Hex(??-?)]Hex(??-?)HexNAc(??-?)HexNAc
- N-Linked / Undefined core / NeuAc(??-?)Hex(??-?)HexNAc(??-?)Hex(??-?)[Fuc(??-?)Hex(??-?)HexNAc(??-?)Hex(??-?)]Hex(??-?)HexNAc(??-?)[Fuc(??-?)]HexNAc
- O-Linked / Core 1 / Gal(b1-3)GalNAc
- O-Linked / Core 1 / NeuAc(a2-3)Gal(b1-3)GalNAc
Reported structure
- Hex:1 (avg mass : 180.1577 )
- Hex:1 HexNAc:1 (avg mass : 383.3527 )
- Hex:1 HexNAc:1 NeuAc:1 (avg mass : 674.6106 )
- Hex:2 HexNAc:2 dHex:1 (avg mass : 894.8331 )
- Hex:3 HexNAc:2 (avg mass : 910.8325 )
- Hex:3 HexNAc:2 dHex:1 (avg mass : 1056.9755 )
- Hex:3 HexNAc:2 dHex:2 (avg mass : 1203.1185 )
- Hex:3 HexNAc:3 (avg mass : 1114.0275 )
- Hex:3 HexNAc:3 dHex:1 (avg mass : 1260.1705 )
- Hex:3 HexNAc:5 dHex:1 (avg mass : 1666.5605 )
- Hex:3 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2161.0134 )
- Hex:3 HexNAc:6 dHex:1 NeuAc:2 (avg mass : 2452.2713 )
- Hex:3 HexNAc:7 (avg mass : 1926.8075 )
- Hex:4 HexNAc:3 (avg mass : 1276.1699 )
- Hex:4 HexNAc:3 NeuAc:1 (avg mass : 1567.4278 )
- Hex:4 HexNAc:3 dHex:1 (avg mass : 1422.3129 )
- Hex:4 HexNAc:3 dHex:2 (avg mass : 1568.4559 )
- Hex:4 HexNAc:4 (avg mass : 1479.3649 )
- Hex:4 HexNAc:4 NeuAc:1 (avg mass : 1770.6228 )
- Hex:4 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 1916.7658 )
- Hex:4 HexNAc:4 dHex:2 (avg mass : 1771.6509 )
- Hex:4 HexNAc:4 dHex:2 NeuAc:1 (avg mass : 2062.9088 )
- Hex:4 HexNAc:5 NeuAc:1 NeuGc:1 (avg mass : 2281.0751 )
- Hex:4 HexNAc:5 dHex:2 NeuAc:1 (avg mass : 2266.1038 )
- Hex:4 HexNAc:6 dHex:1 (avg mass : 2031.8979 )
- Hex:4 HexNAc:6 dHex:2 (avg mass : 2178.0409 )
- Hex:4 HexNAc:9 (avg mass : 2495.3399 )
- Hex:5 HexNAc:2 (avg mass : 1235.1173 )
- Hex:5 HexNAc:4 (avg mass : 1641.5073 )
- Hex:5 HexNAc:4 NeuAc:1 (avg mass : 1932.7652 )
- Hex:5 HexNAc:4 NeuAc:1 NeuGc:1 (avg mass : 2240.0225 )
- Hex:5 HexNAc:4 NeuAc:2 (avg mass : 2224.0231 )
- Hex:5 HexNAc:4 NeuAc:3 (avg mass : 2515.281 )
- Hex:5 HexNAc:4 NeuAc:4 (avg mass : 2806.5389 )
- Hex:5 HexNAc:4 dHex:1 (avg mass : 1787.6503 )
- Hex:5 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 2078.9082 )
- Hex:5 HexNAc:4 dHex:1 NeuAc:2 (avg mass : 2370.1661 )
- Hex:5 HexNAc:4 dHex:1 NeuAc:3 (avg mass : 2661.424 )
- Hex:5 HexNAc:4 dHex:2 NeuAc:1 (avg mass : 2225.0512 )
- Hex:5 HexNAc:5 NeuAc:1 (avg mass : 2135.9602 )
- Hex:5 HexNAc:5 dHex:1 (avg mass : 1990.8453 )
- Hex:5 HexNAc:5 dHex:1 NeuAc:2 (avg mass : 2573.3611 )
- Hex:5 HexNAc:6 dHex:1 (avg mass : 2194.0403 )
- Hex:6 HexNAc:2 (avg mass : 1397.2597 )
- Hex:6 HexNAc:4 NeuAc:1 (avg mass : 2094.9076 )
- Hex:6 HexNAc:4 NeuAc:2 (avg mass : 2386.1655 )
- Hex:6 HexNAc:4 dHex:1 (avg mass : 1949.7927 )
- Hex:6 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 2241.0506 )
- Hex:6 HexNAc:4 dHex:2 (avg mass : 2095.9357 )
- Hex:6 HexNAc:5 (avg mass : 2006.8447 )
- Hex:6 HexNAc:5 NeuAc:1 (avg mass : 2298.1026 )
- Hex:6 HexNAc:5 NeuAc:2 (avg mass : 2589.3605 )
- Hex:6 HexNAc:5 NeuAc:3 (avg mass : 2880.6184 )
- Hex:6 HexNAc:5 NeuAc:4 (avg mass : 3171.8763 )
- Hex:6 HexNAc:5 NeuAc:5 (avg mass : 3463.1342 )
- Hex:6 HexNAc:5 dHex:1 (avg mass : 2152.9877 )
- Hex:6 HexNAc:5 dHex:1 NeuAc:2 (avg mass : 2735.5035 )
- Hex:6 HexNAc:5 dHex:1 NeuAc:3 (avg mass : 3026.7614 )
- Hex:6 HexNAc:6 (avg mass : 2210.0397 )
- Hex:7 HexNAc:2 (avg mass : 1559.4021 )
- Hex:7 HexNAc:9 dHex:1 NeuAc:1 (avg mass : 3419.168 )
- Hex:7 HexNAc:9 dHex:1 NeuAc:2 (avg mass : 3710.4259 )
- Hex:8 HexNAc:2 (avg mass : 1721.5445 )
- Hex:9 HexNAc:2 (avg mass : 1883.6869 )
- Hex:10 HexNAc:2 (avg mass : 2045.8293 )
- Hex:11 HexNAc:6 NeuAc:2 (avg mass : 3603.2675 )
- Hex:12 HexNAc:2 (avg mass : 2370.1141 )
Composition
- Cancer, breast (DOID:1612)
- Carbohydrate-Deficient Glycoprotein Syndrome, Type II (DOID:5212)
- Carcinoma, Hepatocellular (DOID:684)
- Familial hepatic adenoma (DOID:111366)
- Oral squamous cell carcinoma (DOID:0050866)
- Prostate cancer (DOID:10283)
Disease
- Aberrant sialylation in a patient with a HNF1α variant and liver adenomatosis (2021 - Luisa Sturiale, Marie-Cécile Nassogne, Angelo Palmigiano, Angela Messina, Immacolata Speciale, Rosangela Artuso, Gaetano Bertino, Nicole Revencu, Xavier Stephénne, Cristina De Castro, Gert Matthijs, Rita Barone, Jaak Jaeken, Domenico Garozzo) / Status : Reviewed
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Tongue Cancer Patients Can be Distinguished from Healthy Controls by Specific N-Glycopeptides Found in Serum. (2018 - Mayank Saraswat, Antti Mäkitie, Tiialotta Tohmola, Amy Dickinson, Shruti Saraswat, Sakari Joenväärä, Suvi Renkonen) / Status : Reviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Comparison of sialylated N-glycopeptide levels in serum of pancreatic cancer patients, acute pancreatitis patients, and healthy controls (2014 - Kontro H, Joenväärä S, Haglund C, Renkonen R) / Status : Reviewed
- Confident assignment of site-specific glycosylation in complex glycoproteins in a single step (2014 - Khatri K, Staples GO, Leymarie N, Leon DR, Turiák L, Huang Y, Yip S, Hu H, Heckendorf CF, Zaia J.) / Status : Reviewed
- Glycomic analysis of high density lipoprotein shows a highly sialylated particle (2014 - Huang J1, Lee H, Zivkovic AM, Smilowitz JT, Rivera N, German JB, Lebrilla CB) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Enrichment of glycopeptides for glycan structure and attachment site identification (2009 - Nilsson J, Rüetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G.) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
- X-ray crystallography and mass spectroscopy reveal that the N-lobe of human transferrin expressed in Pichia pastoris is folded correctly but is glycosylated on serine-32. (1999 - Bewley M, Tam B, Grewal J, He S, Shewry S, Murphy M, Mason A, Woodworth R, Baker E, MacGillivray R) / Status : Reviewed
- Two-dimensional chromatography in the analysis of complex glycans from transferrin. (1998 - Charlwood J, Birrell H, Tolson D, Camilleri P) / Status : Reviewed
- Expression of N-linked sialyl Le(x) determinants and O-glycans in the carbohydrate moiety of human amniotic fluid transferrin during pregnancy. (1998 - van Rooijen J, Jeschke U, Kamerling J, Vliegenthart J) / Status : Reviewed
- 'Brain-type' N-glycosylation of asialo-transferrin from human cerebrospinal fluid. (1995 - Hoffmann A, Nimtz M, Getzlaff R, Conradt H) / Status : Reviewed
- Carbohydrate deficient glycoprotein syndrome type II: a deficiency in Golgi localised N-acetyl-glucosaminyltransferase II. (1994 - Jaeken J, Schachter H, Carchon H, De Cock P, Coddeville B, Spik G) / Status : Reviewed
- Alteration of asparagine-linked glycosylation in serum transferrin of patients with hepatocellular carcinoma. (1994 - Matsumoto K, Maeda Y, Kato S, Yuki H) / Status : Reviewed
- N-glycosylation site mapping of human serotransferrin by serial lectin affinity chromatography, fast atom bombardment-mass spectrometry, and 1H nuclear magnetic resonance spectroscopy. (1992 - Fu D, van Halbeek H) / Status : Reviewed
Reference
- Serotransferrin / Homo sapiens
Reported glycosite
- CGIVPVIAENYNK (13aa)
- CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa)
- KCGLVPVLAENYNKSDNCEDTPEAGYFAIAVVKK (34aa)
- KCGLVPVLAENYNKS (15aa)
- KCGLVPVLAENYNK (14aa)
- CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKK (33aa)
- CGLVPVLAENYNK (13aa)
- LAENYNK (7aa)
- GLVPVLAENYNK (12aa)
- CGLVPVLAENYNKSDNCEDTPEAGYF (26aa)
- LCMGSGLNLCEPNNK (15aa)
- RQQQHLFGSNVTDCSGNFCLFRS (23aa)
- QQQHLFGSNVTDC (13aa)
- QQQHLFGSNVTDCS (14aa)
- QQQHLFGSNVTDCSGNFC (18aa)
- QQQHLFGSNVTDCSGN (16aa)
- LFGSNVTDCSGNFCLFR (17aa)
- QQQHLFGSNVTDCSGNFCLF (20aa)
- QQQHLFGSNVTDCSGNFCLFR (21aa)
- QQQHLFGSNVTDCSGNF (17aa)
- QQQHLFGSNVTD (12aa)
- QQQHIFGSNVTDCSGNFCIFR (21aa)
- ILRQQQHLFGSNVTDCSGNFCLFR (24aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 1114.0275)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
-
Serotransferrin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1260.1705)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
-
Serotransferrin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1260.1705)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
-
Serotransferrin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1276.1699)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
-
Serotransferrin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1422.3129)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
-
Serotransferrin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1567.4278)
- Blood Serum (UBERON_0001977)
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1568.4559)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
-
Serotransferrin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1641.5073)
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Enrichment of glycopeptides for glycan structure and attachment site identification (2009 - Nilsson J, Rüetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G.) / Status : Reviewed
- Two-dimensional chromatography in the analysis of complex glycans from transferrin. (1998 - Charlwood J, Birrell H, Tolson D, Camilleri P) / Status : Reviewed
- Serotransferrin / Homo sapiens
- KCGLVPVLAENYNKS (15aa)
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1641.5073)
- Carcinoma, Hepatocellular (DOID:684)
- Two-dimensional chromatography in the analysis of complex glycans from transferrin. (1998 - Charlwood J, Birrell H, Tolson D, Camilleri P) / Status : Reviewed
- 'Brain-type' N-glycosylation of asialo-transferrin from human cerebrospinal fluid. (1995 - Hoffmann A, Nimtz M, Getzlaff R, Conradt H) / Status : Reviewed
- Alteration of asparagine-linked glycosylation in serum transferrin of patients with hepatocellular carcinoma. (1994 - Matsumoto K, Maeda Y, Kato S, Yuki H) / Status : Reviewed
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1641.5073)
- Blood Serum (UBERON_0001977)
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1666.5605)
-
Serotransferrin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1787.6503)
-
Serotransferrin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1787.6503)
-
Serotransferrin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1787.6503)
- Milk (UBERON_0001913)
- Serotransferrin / Homo sapiens
- KCGLVPVLAENYNKS (15aa)
-
- N-Linked / Complex
(avg mass : 1787.6503)
- Blood Serum (UBERON_0001977)
- Carcinoma, Hepatocellular (DOID:684)
-
Serotransferrin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1787.6503)
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1932.7652)
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1932.7652)
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1932.7652)
- Amniotic Fluid (UBERON_0000173)
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1932.7652)
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1932.7652)
- Milk (UBERON_0001913)
- Serotransferrin / Homo sapiens
- KCGLVPVLAENYNKS (15aa)
- RQQQHLFGSNVTDCSGNFCLFRS (23aa)
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1932.7652)
- Blood Serum (UBERON_0001977)
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1990.8453)
- Blood Serum (UBERON_0001977)
- Carcinoma, Hepatocellular (DOID:684)
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2006.8447)
- Serotransferrin / Homo sapiens
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2006.8447)
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2078.9082)
- Milk (UBERON_0001913)
- Serotransferrin / Homo sapiens
- KCGLVPVLAENYNKS (15aa)
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2078.9082)
- Amniotic Fluid (UBERON_0000173)
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2078.9082)
- Blood Serum (UBERON_0001977)
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2152.9877)
-
Serotransferrin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2210.0397)
- Milk (UBERON_0001913)
- Serotransferrin / Homo sapiens
- KCGLVPVLAENYNKSDNCEDTPEAGYFAIAVVKK (34aa)
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2224.0231)
- Milk (UBERON_0001913)
- Serotransferrin / Homo sapiens
- KCGLVPVLAENYNKS (15aa)
- RQQQHLFGSNVTDCSGNFCLFRS (23aa)
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2224.0231)
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2224.0231)
- Amniotic Fluid (UBERON_0000173)
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2224.0231)
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2224.0231)
- Two-dimensional chromatography in the analysis of complex glycans from transferrin. (1998 - Charlwood J, Birrell H, Tolson D, Camilleri P) / Status : Reviewed
- Expression of N-linked sialyl Le(x) determinants and O-glycans in the carbohydrate moiety of human amniotic fluid transferrin during pregnancy. (1998 - van Rooijen J, Jeschke U, Kamerling J, Vliegenthart J) / Status : Reviewed
- N-glycosylation site mapping of human serotransferrin by serial lectin affinity chromatography, fast atom bombardment-mass spectrometry, and 1H nuclear magnetic resonance spectroscopy. (1992 - Fu D, van Halbeek H) / Status : Reviewed
- Serotransferrin / Homo sapiens
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2224.0231)
- Blood Serum (UBERON_0001977)
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2224.0231)
- Blood Serum (UBERON_0001977)
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2225.0512)
- Milk (UBERON_0001913)
- Serotransferrin / Homo sapiens
- KCGLVPVLAENYNKS (15aa)
- RQQQHLFGSNVTDCSGNFCLFRS (23aa)
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2298.1026)
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2298.1026)
- Milk (UBERON_0001913)
- Serotransferrin / Homo sapiens
- KCGLVPVLAENYNKS (15aa)
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2298.1026)
- Blood Serum (UBERON_0001977)
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2370.1661)
- Amniotic Fluid (UBERON_0000173)
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2370.1661)
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2370.1661)
- Amniotic Fluid (UBERON_0000173)
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2370.1661)
- Amniotic Fluid (UBERON_0000173)
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2370.1661)
- Blood Serum (UBERON_0001977)
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2515.281)
- Blood Serum (UBERON_0001977)
-
Serotransferrin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2515.281)
- Blood Serum (UBERON_0001977)
-
Serotransferrin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2515.281)
- Blood Serum (UBERON_0001977)
-
Serotransferrin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2573.3611)
- Blood Serum (UBERON_0001977)
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2573.3611)
- Blood Serum (UBERON_0001977)
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2589.3605)
- Milk (UBERON_0001913)
- Serotransferrin / Homo sapiens
- KCGLVPVLAENYNKS (15aa)
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2589.3605)
- Blood Serum (UBERON_0001977)
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2661.424)
- Blood Serum (UBERON_0001977)
-
Serotransferrin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2735.5035)
- Blood Serum (UBERON_0001977)
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2806.5389)
- Blood Serum (UBERON_0001977)
-
Serotransferrin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Amniotic Fluid (UBERON_0000173)
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Expression of N-linked sialyl Le(x) determinants and O-glycans in the carbohydrate moiety of human amniotic fluid transferrin during pregnancy. (1998 - van Rooijen J, Jeschke U, Kamerling J, Vliegenthart J) / Status : Reviewed
- N-glycosylation site mapping of human serotransferrin by serial lectin affinity chromatography, fast atom bombardment-mass spectrometry, and 1H nuclear magnetic resonance spectroscopy. (1992 - Fu D, van Halbeek H) / Status : Reviewed
- Serotransferrin / Homo sapiens
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Expression of N-linked sialyl Le(x) determinants and O-glycans in the carbohydrate moiety of human amniotic fluid transferrin during pregnancy. (1998 - van Rooijen J, Jeschke U, Kamerling J, Vliegenthart J) / Status : Reviewed
- N-glycosylation site mapping of human serotransferrin by serial lectin affinity chromatography, fast atom bombardment-mass spectrometry, and 1H nuclear magnetic resonance spectroscopy. (1992 - Fu D, van Halbeek H) / Status : Reviewed
- Serotransferrin / Homo sapiens
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Amniotic Fluid (UBERON_0000173)
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2880.6184)
- Blood Serum (UBERON_0001977)
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 3026.7614)
- Amniotic Fluid (UBERON_0000173)
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 3026.7614)
- Amniotic Fluid (UBERON_0000173)
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 3026.7614)
- Amniotic Fluid (UBERON_0000173)
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 3026.7614)
- Blood Serum (UBERON_0001977)
-
Serotransferrin / Homo sapiens
- Undefined site
- Serotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 3171.8763)
- Blood Serum (UBERON_0001977)
-
Serotransferrin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 3171.8763)
- Blood Serum (UBERON_0001977)
-
Serotransferrin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 3171.8763)
- Blood Serum (UBERON_0001977)
-
Serotransferrin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 3463.1342)
- Blood Serum (UBERON_0001977)
-
Serotransferrin / Homo sapiens
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 1235.1173)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
-
Serotransferrin / Homo sapiens
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 1397.2597)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
-
Serotransferrin / Homo sapiens
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 1397.2597)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
-
Serotransferrin / Homo sapiens
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 1559.4021)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
-
Serotransferrin / Homo sapiens
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 1559.4021)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
-
Serotransferrin / Homo sapiens
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 1721.5445)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
-
Serotransferrin / Homo sapiens
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 1721.5445)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
-
Serotransferrin / Homo sapiens
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 1883.6869)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
-
Serotransferrin / Homo sapiens
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 2045.8293)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
-
Serotransferrin / Homo sapiens
- Undefined site
-
- N-Linked / No-core
(avg mass : 894.8331)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
-
Serotransferrin / Homo sapiens
- Undefined site
-
- N-Linked / Pauci-Mannose
(avg mass : 910.8325)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
-
Serotransferrin / Homo sapiens
- Undefined site
-
- N-Linked / Pauci-Mannose
(avg mass : 1056.9755)
- N-Linked / Pauci-Mannose
(avg mass : 1056.9755)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Pauci-Mannose
(avg mass : 910.8325)
Source
Reported glycosite
Suggested glycosite
- N-Linked / No-core
(avg mass : 894.8331)
Source
Reported glycosite
Suggested glycosite
- N-Linked / High-Mannose
(avg mass : 2045.8293)
Source
Reported glycosite
Suggested glycosite
- N-Linked / High-Mannose
(avg mass : 1883.6869)
Source
Reported glycosite
Suggested glycosite
- N-Linked / High-Mannose
(avg mass : 1721.5445)
Source
Reported glycosite
Suggested glycosite
- N-Linked / High-Mannose
(avg mass : 1721.5445)
Source
Reported glycosite
Suggested glycosite
- N-Linked / High-Mannose
(avg mass : 1559.4021)
Source
Reported glycosite
Suggested glycosite
- N-Linked / High-Mannose
(avg mass : 1559.4021)
Source
Reported glycosite
Suggested glycosite
- N-Linked / High-Mannose
(avg mass : 1397.2597)
Source
Reported glycosite
Suggested glycosite
- N-Linked / High-Mannose
(avg mass : 1397.2597)
Source
Reported glycosite
Suggested glycosite
- N-Linked / High-Mannose
(avg mass : 1235.1173)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 3463.1342)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 3171.8763)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 3171.8763)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 3171.8763)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 3026.7614)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 3026.7614)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 3026.7614)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 3026.7614)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Reference
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Reference
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2880.6184)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2806.5389)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2735.5035)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2661.424)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2589.3605)
Source
Reported glycosite
Mass spectrometry observed peptide
Suggested glycosite
- N-Linked / Complex
(avg mass : 2589.3605)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2573.3611)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2573.3611)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2515.281)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2515.281)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2515.281)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2370.1661)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2370.1661)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2370.1661)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2370.1661)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2370.1661)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2298.1026)
Source
Reported glycosite
Mass spectrometry observed peptide
Suggested glycosite
- N-Linked / Complex
(avg mass : 2298.1026)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2298.1026)
Source
Reported glycosite
Mass spectrometry observed peptide
Suggested glycosite
- N-Linked / Complex
(avg mass : 2225.0512)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2224.0231)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2224.0231)
Reference
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2224.0231)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2224.0231)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2224.0231)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2224.0231)
Source
Reported glycosite
Mass spectrometry observed peptide
Suggested glycosite
- N-Linked / Complex
(avg mass : 2224.0231)
Source
Reported glycosite
Mass spectrometry observed peptide
Suggested glycosite
- N-Linked / Complex
(avg mass : 2210.0397)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2152.9877)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2078.9082)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2078.9082)
Source
Reported glycosite
Mass spectrometry observed peptide
Suggested glycosite
- N-Linked / Complex
(avg mass : 2078.9082)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2006.8447)
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 2006.8447)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1990.8453)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1932.7652)
Source
Reported glycosite
Mass spectrometry observed peptide
Suggested glycosite
- N-Linked / Complex
(avg mass : 1932.7652)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1932.7652)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1932.7652)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1932.7652)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1932.7652)
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1787.6503)
Source
Disease
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1787.6503)
Source
Reported glycosite
Mass spectrometry observed peptide
Suggested glycosite
- N-Linked / Complex
(avg mass : 1787.6503)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1787.6503)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1787.6503)
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1641.5073)
Disease
Reference
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1641.5073)
Reference
Reported glycosite
Mass spectrometry observed peptide
Suggested glycosite
- N-Linked / Complex
(avg mass : 1641.5073)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1568.4559)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1567.4278)
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1479.3649)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1422.3129)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1276.1699)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1260.1705)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1260.1705)
Source
Reported glycosite
Suggested glycosite
- N-Linked / Complex
(avg mass : 1114.0275)