GlyConnect

Export CSV

Site	Core / Type	Cartoon	Composition	Biological associations
Asn-513	N-Linked / Complex		Hex:5 HexNAc:4 NeuGc:3	taxonomy (1) protein (1) source (1) structure (1) composition (1) disease (0) reference (1) site (1) peptide (0) Taxonomy Mus musculus (House mouse) Protein Serotransferrin / Mus musculus Q921I1 Source Blood Serum (UBERON_0001977) Reported structure N-Linked / Complex / Structure 90 Composition Hex:5 HexNAc:4 NeuGc:3 (avg mass : 2563.2792 ) Disease Reference Sialic acid-focused quantitative mouse serum glycoproteomics by multiple reaction monitoring assay. (2010 - Kurogochi M, Matsushista T, Amano M, Furukawa J, Shinohara Y, Aoshima M, Nishimura S) / Status : Reviewed Reported glycosite Serotransferrin / Mus musculus Asn-513 Mass spectrometry observed peptide
Asn-513	N-Linked / Complex		Hex:5 HexNAc:4 dHex:1 NeuGc:2	taxonomy (1) protein (1) source (1) structure (1) composition (1) disease (0) reference (1) site (1) peptide (0) Taxonomy Mus musculus (House mouse) Protein Serotransferrin / Mus musculus Q921I1 Source Blood Serum (UBERON_0001977) Reported structure N-Linked / Complex / Structure 430 Composition Hex:5 HexNAc:4 dHex:1 NeuGc:2 (avg mass : 2402.1649 ) Disease Reference Sialic acid-focused quantitative mouse serum glycoproteomics by multiple reaction monitoring assay. (2010 - Kurogochi M, Matsushista T, Amano M, Furukawa J, Shinohara Y, Aoshima M, Nishimura S) / Status : Reviewed Reported glycosite Serotransferrin / Mus musculus Asn-513 Mass spectrometry observed peptide
Asn-513	N-Linked / Undefined core		Hex:3 HexNAc:6	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (0) reference (1) site (1) peptide (1) Taxonomy Mus musculus (House mouse) Protein Serotransferrin / Mus musculus Q921I1 Source Brain (UBERON_0000955) Reported structure Composition Hex:3 HexNAc:6 (avg mass : 1723.6125 ) Disease Reference Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed Reported glycosite Serotransferrin / Mus musculus Asn-513 Mass spectrometry observed peptide INHCKFDEFFSQGCAPGYEKNSTLCDLCIGPLK (33aa) Q921I1 Asn-513 Serotransferrin / Mus musculus
Asn-513	N-Linked / Undefined core		Hex:9 HexNAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (0) reference (1) site (1) peptide (2) Taxonomy Mus musculus (House mouse) Protein Serotransferrin / Mus musculus Q921I1 Source Brain (UBERON_0000955) Reported structure Composition Hex:9 HexNAc:2 (avg mass : 1883.6869 ) Disease Reference Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed Reported glycosite Serotransferrin / Mus musculus Asn-513 Mass spectrometry observed peptide FDEFFSQGCAPGYEKNSTLCDLCIGPLK (28aa) Q921I1 Asn-513 Serotransferrin / Mus musculus NSTLCDLCIGPLK (13aa) Q921I1 Asn-513 Serotransferrin / Mus musculus
Asn-513	N-Linked / Undefined core		Hex:5 HexNAc:4 dHex:1	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (0) reference (1) site (1) peptide (1) Taxonomy Mus musculus (House mouse) Protein Serotransferrin / Mus musculus Q921I1 Source Brain (UBERON_0000955) Reported structure Composition Hex:5 HexNAc:4 dHex:1 (avg mass : 1787.6503 ) Disease Reference Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed Reported glycosite Serotransferrin / Mus musculus Asn-513 Mass spectrometry observed peptide FDEFFSQGCAPGYEKNSTLCDLCIGPLK (28aa) Q921I1 Asn-513 Serotransferrin / Mus musculus
Asn-513	N-Linked / Undefined core		Hex:5 HexNAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (0) reference (1) site (1) peptide (2) Taxonomy Mus musculus (House mouse) Protein Serotransferrin / Mus musculus Q921I1 Source Brain (UBERON_0000955) Reported structure Composition Hex:5 HexNAc:2 (avg mass : 1235.1173 ) Disease Reference Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed Reported glycosite Serotransferrin / Mus musculus Asn-513 Mass spectrometry observed peptide FDEFFSQGCAPGYEKNSTLCDLCIGPLK (28aa) Q921I1 Asn-513 Serotransferrin / Mus musculus NSTLCDLCIGPLK (13aa) Q921I1 Asn-513 Serotransferrin / Mus musculus
Asn-513	N-Linked / Undefined core		Hex:8 HexNAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (0) reference (1) site (1) peptide (2) Taxonomy Mus musculus (House mouse) Protein Serotransferrin / Mus musculus Q921I1 Source Brain (UBERON_0000955) Reported structure Composition Hex:8 HexNAc:2 (avg mass : 1721.5445 ) Disease Reference Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed Reported glycosite Serotransferrin / Mus musculus Asn-513 Mass spectrometry observed peptide FDEFFSQGCAPGYEKNSTLCDLCIGPLK (28aa) Q921I1 Asn-513 Serotransferrin / Mus musculus NSTLCDLCIGPLK (13aa) Q921I1 Asn-513 Serotransferrin / Mus musculus
Asn-513	N-Linked / Undefined core		Hex:4 HexNAc:6	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (0) reference (1) site (1) peptide (1) Taxonomy Mus musculus (House mouse) Protein Serotransferrin / Mus musculus Q921I1 Source Brain (UBERON_0000955) Reported structure Composition Hex:4 HexNAc:6 (avg mass : 1885.7549 ) Disease Reference Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed Reported glycosite Serotransferrin / Mus musculus Asn-513 Mass spectrometry observed peptide FDEFFSQGCAPGYEKNSTLCDLCIGPLK (28aa) Q921I1 Asn-513 Serotransferrin / Mus musculus
Asn-513	N-Linked / Complex		Hex:5 HexNAc:4 NeuGc:2	taxonomy (1) protein (1) source (1) structure (1) composition (1) disease (0) reference (1) site (1) peptide (0) Taxonomy Mus musculus (House mouse) Protein Serotransferrin / Mus musculus Q921I1 Source Blood Serum (UBERON_0001977) Reported structure N-Linked / Complex / Structure 3649 Composition Hex:5 HexNAc:4 NeuGc:2 (avg mass : 2256.0219 ) Disease Reference Sialic acid-focused quantitative mouse serum glycoproteomics by multiple reaction monitoring assay. (2010 - Kurogochi M, Matsushista T, Amano M, Furukawa J, Shinohara Y, Aoshima M, Nishimura S) / Status : Reviewed Reported glycosite Serotransferrin / Mus musculus Asn-513 Mass spectrometry observed peptide

← Previous
Displaying 1 to 9 of 9
Next →

Show all