GlyConnect

Export CSV

Site	Core / Type	Cartoon	Composition	Biological associations
Asn-322	N-Linked / High-Mannose		Hex:7 HexNAc:2	taxonomy (1) protein (1) source (1) structure (1) composition (1) disease (0) reference (1) site (1) peptide (2) Taxonomy Homo sapiens (Human) Protein Lactoperoxidase / Homo sapiens P22079 Source Milk (UBERON_0001913) Reported structure N-Linked / High-Mannose / Structure 314 Composition Hex:7 HexNAc:2 (avg mass : 1559.4021 ) Disease Reference Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed Reported glycosite Lactoperoxidase / Homo sapiens Asn-322 Mass spectrometry observed peptide RLRNLSSPLGLMAVNQEVSDHGLPYLPYDSKK (32aa) P22079 Asn-322 Lactoperoxidase / Homo sapiens RNLSSPLGLMAVNQEVSDHGLPYLPYDSKK (30aa) P22079 Asn-322 Lactoperoxidase / Homo sapiens
Asn-322	N-Linked / High-Mannose		Hex:6 HexNAc:2	taxonomy (1) protein (1) source (1) structure (1) composition (1) disease (0) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Lactoperoxidase / Homo sapiens P22079 Source Milk (UBERON_0001913) Reported structure N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc Composition Hex:6 HexNAc:2 (avg mass : 1397.2597 ) Disease Reference Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed Reported glycosite Lactoperoxidase / Homo sapiens Asn-322 Mass spectrometry observed peptide RNLSSPLGLMAVNQEVSDHGLPYLPYDSKK (30aa) P22079 Asn-322 Lactoperoxidase / Homo sapiens

← Previous
Displaying 1 to 2 of 2
Next →

Show all