GlyConnect

Export CSV

Site	Core / Type	Cartoon	Composition	Biological associations
Thr-123	O-Linked / O-GlcNAc		HexNAc:1	taxonomy (1) protein (1) source (0) structure (1) composition (1) disease (0) reference (1) site (6) peptide (1) Taxonomy Homo sapiens (Human) Protein Microtubule-associated protein tau / Homo sapiens P10636 Source Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Mapping O-GlcNAc modification sites on tau and generation of a site-specific O-GlcNAc tau antibody (2011 - Scott A Yuzwa, Anuj K Yadav, Yuliya Skorobogatko, Thomas Clark, Keith Vosseller, David J Vocadlo) / Status : Unreviewed Reported glycosite Microtubule-associated protein tau / Homo sapiens Thr-123 Ser-208 Ser-238 Ser-400 Ser-409/Ser-412/Ser-413 Ser-489 Mass spectrometry observed peptide DTPSLEDEAAGHVTQAR (17aa) P10636 Thr-123 Microtubule-associated protein tau / Homo sapiens
Ser-208	O-Linked / O-GlcNAc		HexNAc:1	taxonomy (1) protein (1) source (0) structure (1) composition (1) disease (0) reference (1) site (6) peptide (1) Taxonomy Homo sapiens (Human) Protein Microtubule-associated protein tau / Homo sapiens P10636 Source Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Identification of O-GlcNAc sites within peptides of the Tau protein and their impact on phosphorylation (2011 - Caroline Smet-Nocca, Malgorzata Broncel, Jean-Michel Wieruszeski, Caroline Tokarski, Xavier Hanoulle, Arnaud Leroy, Isabelle Landrieu, Christian Rolando, Guy Lippens, Christian P R Hackenberger) / Status : Unreviewed Reported glycosite Microtubule-associated protein tau / Homo sapiens Thr-123 Ser-208 Ser-238 Ser-400 Ser-409/Ser-412/Ser-413 Ser-489 Mass spectrometry observed peptide SPVVSGDTSPR (11aa) P10636 Ser-208 Microtubule-associated protein tau / Homo sapiens
Ser-238	O-Linked / O-GlcNAc		HexNAc:1	taxonomy (1) protein (1) source (0) structure (1) composition (1) disease (0) reference (1) site (6) peptide (1) Taxonomy Homo sapiens (Human) Protein Microtubule-associated protein tau / Homo sapiens P10636 Source Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Identification of O-GlcNAc sites within peptides of the Tau protein and their impact on phosphorylation (2011 - Caroline Smet-Nocca, Malgorzata Broncel, Jean-Michel Wieruszeski, Caroline Tokarski, Xavier Hanoulle, Arnaud Leroy, Isabelle Landrieu, Christian Rolando, Guy Lippens, Christian P R Hackenberger) / Status : Unreviewed Reported glycosite Microtubule-associated protein tau / Homo sapiens Thr-123 Ser-208 Ser-238 Ser-400 Ser-409/Ser-412/Ser-413 Ser-489 Mass spectrometry observed peptide HLSNVSSTGSIDMVDSPQLATLADEVSASLAK (32aa) P10636 Ser-238 Microtubule-associated protein tau / Homo sapiens
Ser-400	O-Linked / O-GlcNAc		HexNAc:1	taxonomy (1) protein (1) source (0) structure (1) composition (1) disease (0) reference (1) site (6) peptide (1) Taxonomy Homo sapiens (Human) Protein Microtubule-associated protein tau / Homo sapiens P10636 Source Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Mapping O-GlcNAc modification sites on tau and generation of a site-specific O-GlcNAc tau antibody (2011 - Scott A Yuzwa, Anuj K Yadav, Yuliya Skorobogatko, Thomas Clark, Keith Vosseller, David J Vocadlo) / Status : Unreviewed Reported glycosite Microtubule-associated protein tau / Homo sapiens Thr-123 Ser-208 Ser-238 Ser-400 Ser-409/Ser-412/Ser-413 Ser-489 Mass spectrometry observed peptide GSPGTPGSRSRTPSL (15aa) P10636 Ser-400 Microtubule-associated protein tau / Homo sapiens
Ser-409/Ser-412/Ser-413	O-Linked / O-GlcNAc		HexNAc:1	taxonomy (1) protein (1) source (0) structure (1) composition (1) disease (0) reference (1) site (6) peptide (1) Taxonomy Homo sapiens (Human) Protein Microtubule-associated protein tau / Homo sapiens P10636 Source Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Mapping O-GlcNAc modification sites on tau and generation of a site-specific O-GlcNAc tau antibody (2011 - Scott A Yuzwa, Anuj K Yadav, Yuliya Skorobogatko, Thomas Clark, Keith Vosseller, David J Vocadlo) / Status : Unreviewed Reported glycosite Microtubule-associated protein tau / Homo sapiens Thr-123 Ser-208 Ser-238 Ser-400 Ser-409/Ser-412/Ser-413 Ser-489 Mass spectrometry observed peptide TPPKSPSSAKSRLQT (15aa) P10636 Ser-409/Ser-412/Ser-413 Microtubule-associated protein tau / Homo sapiens
Ser-489	O-Linked / O-GlcNAc		HexNAc:1	taxonomy (1) protein (1) source (1) structure (1) composition (1) disease (0) reference (1) site (6) peptide (1) Taxonomy Homo sapiens (Human) Protein Microtubule-associated protein tau / Homo sapiens P10636 Source HeLa (CVCL_0030) Reported structure O-Linked / O-GlcNAc / GlcNAc(b Composition HexNAc:1 (avg mass : 221.2103 ) Disease Reference Extensive Crosstalk Between O-GlcNAcylation and Phosphorylation Regulates Cytokinesis (2010 - Zihao Wang, Namrata D Udeshi, Chad Slawson, Philip D Compton, Kaoru Sakabe, Win D Cheung, Jeffrey Shabanowitz, Donald F Hunt, Gerald W Hart) / Status : Reviewed Reported glycosite Microtubule-associated protein tau / Homo sapiens Thr-123 Ser-208 Ser-238 Ser-400 Ser-409/Ser-412/Ser-413 Ser-489 Mass spectrometry observed peptide PVVSSAGTTSDK (12aa) P10636 Ser-489 Microtubule-associated protein tau / Homo sapiens

← Previous
Displaying 1 to 6 of 6
Next →

Show all