GlyConnect

Export CSV

Site	Core / Type	Cartoon	Composition	Biological associations
Asn-163	N-Linked / Undefined core		Hex:3 HexNAc:6	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (0) reference (1) site (1) peptide (1) Taxonomy Mus musculus (House mouse) Protein Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Q9R1V6-16 Source Brain (UBERON_0000955) Reported structure Composition Hex:3 HexNAc:6 (avg mass : 1723.6125 ) Disease Reference Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed Reported glycosite Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Asn-163 Mass spectrometry observed peptide GNPVSFVALSTCHGLHGMFYDGNHTYLIEPEENEK (35aa) Q9R1V6-16 Asn-163 Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
Asn-517	N-Linked / Undefined core		Hex:7 HexNAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (0) reference (1) site (1) peptide (1) Taxonomy Mus musculus (House mouse) Protein Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Q9R1V6-16 Source Brain (UBERON_0000955) Reported structure Composition Hex:7 HexNAc:2 (avg mass : 1559.4021 ) Disease Reference Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed Reported glycosite Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Asn-517 Mass spectrometry observed peptide EICSGNSSQCAPNVHK (16aa) Q9R1V6-16 Asn-517 Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
Asn-517	N-Linked / Undefined core		Hex:9 HexNAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (0) reference (1) site (1) peptide (1) Taxonomy Mus musculus (House mouse) Protein Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Q9R1V6-16 Source Brain (UBERON_0000955) Reported structure Composition Hex:9 HexNAc:2 (avg mass : 1883.6869 ) Disease Reference Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed Reported glycosite Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Asn-517 Mass spectrometry observed peptide EICSGNSSQCAPNVHK (16aa) Q9R1V6-16 Asn-517 Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
Asn-517	N-Linked / Undefined core		Hex:5 HexNAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (0) reference (1) site (1) peptide (1) Taxonomy Mus musculus (House mouse) Protein Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Q9R1V6-16 Source Brain (UBERON_0000955) Reported structure Composition Hex:5 HexNAc:2 (avg mass : 1235.1173 ) Disease Reference Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed Reported glycosite Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Asn-517 Mass spectrometry observed peptide EAVNDCDIREICSGNSSQCAPNVHK (25aa) Q9R1V6-16 Asn-517 Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
Asn-517	N-Linked / Undefined core		Hex:5 HexNAc:3	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (0) reference (1) site (2) peptide (1) Taxonomy Mus musculus (House mouse) Protein Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Q9R1V6-16 Source Brain (UBERON_0000955) Reported structure Composition Hex:5 HexNAc:3 (avg mass : 1438.3123 ) Disease Reference Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed Reported glycosite Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Asn-517 Asn-632 Mass spectrometry observed peptide EICSGNSSQCAPNVHK (16aa) Q9R1V6-16 Asn-517 Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
Asn-517	N-Linked / Undefined core		Hex:6 HexNAc:3 dHex:1	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (0) reference (1) site (1) peptide (1) Taxonomy Mus musculus (House mouse) Protein Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Q9R1V6-16 Source Brain (UBERON_0000955) Reported structure Composition Hex:6 HexNAc:3 dHex:1 (avg mass : 1746.5977 ) Disease Reference Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed Reported glycosite Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Asn-517 Mass spectrometry observed peptide EICSGNSSQCAPNVHK (16aa) Q9R1V6-16 Asn-517 Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
Asn-517	N-Linked / Undefined core		Hex:10 HexNAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (0) reference (1) site (1) peptide (1) Taxonomy Mus musculus (House mouse) Protein Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Q9R1V6-16 Source Brain (UBERON_0000955) Reported structure Composition Hex:10 HexNAc:2 (avg mass : 2045.8293 ) Disease Reference Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed Reported glycosite Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Asn-517 Mass spectrometry observed peptide EICSGNSSQCAPNVHK (16aa) Q9R1V6-16 Asn-517 Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
Asn-632	N-Linked / Undefined core		Hex:6 HexNAc:4 dHex:1	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (0) reference (1) site (1) peptide (1) Taxonomy Mus musculus (House mouse) Protein Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Q9R1V6-16 Source Brain (UBERON_0000955) Reported structure Composition Hex:6 HexNAc:4 dHex:1 (avg mass : 1949.7927 ) Disease Reference Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed Reported glycosite Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Asn-632 Mass spectrometry observed peptide TLNCSGAHVK (10aa) Q9R1V6-16 Asn-632 Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
Asn-632	N-Linked / Undefined core		Hex:5 HexNAc:3 dHex:1	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (0) reference (1) site (1) peptide (1) Taxonomy Mus musculus (House mouse) Protein Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Q9R1V6-16 Source Brain (UBERON_0000955) Reported structure Composition Hex:5 HexNAc:3 dHex:1 (avg mass : 1584.4553 ) Disease Reference Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed Reported glycosite Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Asn-632 Mass spectrometry observed peptide TLNCSGAHVK (10aa) Q9R1V6-16 Asn-632 Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
Asn-632	N-Linked / Undefined core		Hex:5 HexNAc:4 dHex:1	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (0) reference (1) site (1) peptide (1) Taxonomy Mus musculus (House mouse) Protein Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Q9R1V6-16 Source Brain (UBERON_0000955) Reported structure Composition Hex:5 HexNAc:4 dHex:1 (avg mass : 1787.6503 ) Disease Reference Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed Reported glycosite Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Asn-632 Mass spectrometry observed peptide TLNCSGAHVK (10aa) Q9R1V6-16 Asn-632 Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
Asn-632	N-Linked / Undefined core		Hex:5 HexNAc:3	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (0) reference (1) site (2) peptide (1) Taxonomy Mus musculus (House mouse) Protein Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Q9R1V6-16 Source Brain (UBERON_0000955) Reported structure Composition Hex:5 HexNAc:3 (avg mass : 1438.3123 ) Disease Reference Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed Reported glycosite Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Asn-517 Asn-632 Mass spectrometry observed peptide TLNCSGAHVK (10aa) Q9R1V6-16 Asn-632 Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
Asn-632	N-Linked / Undefined core		Hex:4 HexNAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (0) reference (1) site (1) peptide (1) Taxonomy Mus musculus (House mouse) Protein Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Q9R1V6-16 Source Brain (UBERON_0000955) Reported structure Composition Hex:4 HexNAc:2 (avg mass : 1072.9749 ) Disease Reference Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed Reported glycosite Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Asn-632 Mass spectrometry observed peptide TLNCSGAHVK (10aa) Q9R1V6-16 Asn-632 Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus

← Previous
Displaying 1 to 12 of 12
Next →

Show 50 per page