GlyConnect

Site	Core / Type	Cartoon	Composition	Biological associations
Asn-258	N-Linked / Undefined core		Hex:3 HexNAc:5	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (0) reference (1) site (1) peptide (1) Taxonomy Mus musculus (House mouse) Protein Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218 Source Brain (UBERON_0000955) Reported structure Composition Hex:3 HexNAc:5 (avg mass : 1520.4175 ) Disease Reference Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed Reported glycosite Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Asn-258 Mass spectrometry observed peptide LAYATINDSR (10aa) Q9Z218 Asn-258
Asn-258	N-Linked / Undefined core		Hex:3 HexNAc:3	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (0) reference (1) site (1) peptide (1) Taxonomy Mus musculus (House mouse) Protein Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218 Source Brain (UBERON_0000955) Reported structure Composition Hex:3 HexNAc:3 (avg mass : 1114.0275 ) Disease Reference Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed Reported glycosite Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Asn-258 Mass spectrometry observed peptide LAYATINDSR (10aa) Q9Z218 Asn-258
Asn-258	N-Linked / Undefined core		Hex:4 HexNAc:3	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (0) reference (1) site (1) peptide (1) Taxonomy Mus musculus (House mouse) Protein Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218 Source Brain (UBERON_0000955) Reported structure Composition Hex:4 HexNAc:3 (avg mass : 1276.1699 ) Disease Reference Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed Reported glycosite Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Asn-258 Mass spectrometry observed peptide LAYATINDSR (10aa) Q9Z218 Asn-258
Asn-258	N-Linked / Undefined core		Hex:3 HexNAc:6	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (0) reference (1) site (1) peptide (1) Taxonomy Mus musculus (House mouse) Protein Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218 Source Brain (UBERON_0000955) Reported structure Composition Hex:3 HexNAc:6 (avg mass : 1723.6125 ) Disease Reference Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed Reported glycosite Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Asn-258 Mass spectrometry observed peptide LAYATINDSRVPLMELPTYTGSVYPTVKPYHYPK (34aa) Q9Z218 Asn-258
Asn-258	N-Linked / Undefined core		Hex:3 HexNAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (0) reference (1) site (1) peptide (1) Taxonomy Mus musculus (House mouse) Protein Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218 Source Brain (UBERON_0000955) Reported structure Composition Hex:3 HexNAc:2 (avg mass : 910.8325 ) Disease Reference Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed Reported glycosite Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Asn-258 Mass spectrometry observed peptide LAYATINDSR (10aa) Q9Z218 Asn-258
Asn-258	N-Linked / Undefined core		Hex:5 HexNAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (0) reference (1) site (1) peptide (2) Taxonomy Mus musculus (House mouse) Protein Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218 Source Brain (UBERON_0000955) Reported structure Composition Hex:5 HexNAc:2 (avg mass : 1235.1173 ) Disease Reference Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed Reported glycosite Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Asn-258 Mass spectrometry observed peptide LAYATINDSRVPLMELPTYTGSVYPTVKPYHYPK (34aa) Q9Z218 Asn-258 LAYATINDSR (10aa) Q9Z218 Asn-258
Asn-258	N-Linked / Undefined core		Hex:5 HexNAc:3	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (0) reference (1) site (1) peptide (2) Taxonomy Mus musculus (House mouse) Protein Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218 Source Brain (UBERON_0000955) Reported structure Composition Hex:5 HexNAc:3 (avg mass : 1438.3123 ) Disease Reference Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed Reported glycosite Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Asn-258 Mass spectrometry observed peptide LAYATINDSRVPLMELPTYTGSVYPTVKPYHYPK (34aa) Q9Z218 Asn-258 LAYATINDSR (10aa) Q9Z218 Asn-258
Asn-258	N-Linked / Undefined core		Hex:4 HexNAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (0) reference (1) site (1) peptide (1) Taxonomy Mus musculus (House mouse) Protein Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218 Source Brain (UBERON_0000955) Reported structure Composition Hex:4 HexNAc:2 (avg mass : 1072.9749 ) Disease Reference Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed Reported glycosite Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Asn-258 Mass spectrometry observed peptide LAYATINDSR (10aa) Q9Z218 Asn-258
Asn-258	N-Linked / Undefined core		Hex:1 HexNAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (0) reference (1) site (1) peptide (1) Taxonomy Mus musculus (House mouse) Protein Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218 Source Brain (UBERON_0000955) Reported structure Composition Hex:1 HexNAc:2 (avg mass : 586.5477 ) Disease Reference Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed Reported glycosite Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Asn-258 Mass spectrometry observed peptide LAYATINDSR (10aa) Q9Z218 Asn-258
Asn-258	N-Linked / Undefined core		HexNAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (0) reference (1) site (1) peptide (1) Taxonomy Mus musculus (House mouse) Protein Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218 Source Brain (UBERON_0000955) Reported structure Composition HexNAc:2 (avg mass : 424.4053 ) Disease Reference Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed Reported glycosite Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Asn-258 Mass spectrometry observed peptide LAYATINDSR (10aa) Q9Z218 Asn-258

← Previous
Displaying 1 to 10 of 10
Next →

Show all