GlyConnect

Export CSV

Site	Core / Type	Cartoon	Composition	Biological associations
Asn-444	N-Linked / Undefined core		Hex:5 HexNAc:5 dHex:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (0) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Tigger transposable element-derived protein 6 / Homo sapiens Q17RP2 Source Blood Serum (UBERON_0001977) Reported structure Composition Hex:5 HexNAc:5 dHex:2 (avg mass : 2136.9883 ) Disease Reference Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed Reported glycosite Tigger transposable element-derived protein 6 / Homo sapiens Asn-444 Mass spectrometry observed peptide DDLIISQDTDIIQDMVAGENTSEAGSEDEGEVSLPEQPK (39aa) Q17RP2 Asn-444 Tigger transposable element-derived protein 6 / Homo sapiens
Asn-444	N-Linked / Undefined core		Hex:6 HexNAc:6 dHex:1	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (0) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Tigger transposable element-derived protein 6 / Homo sapiens Q17RP2 Source Blood Serum (UBERON_0001977) Reported structure Composition Hex:6 HexNAc:6 dHex:1 (avg mass : 2356.1827 ) Disease Reference Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed Reported glycosite Tigger transposable element-derived protein 6 / Homo sapiens Asn-444 Mass spectrometry observed peptide DDLIISQDTDIIQDMVAGENTSEAGSEDEGEVSLPEQPK (39aa) Q17RP2 Asn-444 Tigger transposable element-derived protein 6 / Homo sapiens
Asn-444	N-Linked / Undefined core		Hex:7 HexNAc:6 dHex:1	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (0) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Tigger transposable element-derived protein 6 / Homo sapiens Q17RP2 Source Blood Serum (UBERON_0001977) Reported structure Composition Hex:7 HexNAc:6 dHex:1 (avg mass : 2518.3251 ) Disease Reference Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed Reported glycosite Tigger transposable element-derived protein 6 / Homo sapiens Asn-444 Mass spectrometry observed peptide DDLIISQDTDIIQDMVAGENTSEAGSEDEGEVSLPEQPK (39aa) Q17RP2 Asn-444 Tigger transposable element-derived protein 6 / Homo sapiens

← Previous
Displaying 1 to 3 of 3
Next →

Show all