GlyConnect

Export CSV

Site	Core / Type	Cartoon	Composition	Biological associations
Asn-132	N-Linked / Undefined core		Hex:5 HexNAc:4 dHex:1 NeuAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Tryptase alpha/beta-1 / Homo sapiens Q15661 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:5 HexNAc:4 dHex:1 NeuAc:2 (avg mass : 2370.1661 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Tryptase alpha/beta-1 / Homo sapiens Asn-132 Mass spectrometry observed peptide IIVHPQFYIIQTGADIALLELEEPVNISSR (30aa) Q15661 Asn-132 Tryptase alpha/beta-1 / Homo sapiens VAR_064288 133:V→I dbSNP:rs200334042 Q15661 Asn-132 Tryptase alpha/beta-1 / Homo sapiens
Asn-132	N-Linked / Undefined core		Hex:12 HexNAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (2) peptide (1) Taxonomy Homo sapiens (Human) Protein Tryptase alpha/beta-1 / Homo sapiens Q15661 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:12 HexNAc:2 (avg mass : 2370.1141 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Tryptase alpha/beta-1 / Homo sapiens Asn-132 Asn-233 Mass spectrometry observed peptide IIVHPQFYIIQTGADIALLELEEPVNISSR (30aa) Q15661 Asn-132 Tryptase alpha/beta-1 / Homo sapiens VAR_064288 133:V→I dbSNP:rs200334042 Q15661 Asn-132 Tryptase alpha/beta-1 / Homo sapiens
Asn-132	N-Linked / Undefined core		Hex:4 HexNAc:3 dHex:1 NeuAc:1	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (2) peptide (1) Taxonomy Homo sapiens (Human) Protein Tryptase alpha/beta-1 / Homo sapiens Q15661 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:4 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 1713.5708 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Tryptase alpha/beta-1 / Homo sapiens Asn-132 Asn-233 Mass spectrometry observed peptide IIVHPQFYIIQTGADIALLELEEPVNISSR (30aa) Q15661 Asn-132 Tryptase alpha/beta-1 / Homo sapiens VAR_064288 133:V→I dbSNP:rs200334042 Q15661 Asn-132 Tryptase alpha/beta-1 / Homo sapiens
Asn-233	N-Linked / Undefined core		Hex:4 HexNAc:2 dHex:1	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Tryptase alpha/beta-1 / Homo sapiens Q15661 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:4 HexNAc:2 dHex:1 (avg mass : 1219.1179 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Tryptase alpha/beta-1 / Homo sapiens Asn-233 Mass spectrometry observed peptide VNGTWLQAGVVSWGEGCAQPNRPGIYTR (28aa) Q15661 Asn-233 Tryptase alpha/beta-1 / Homo sapiens
Asn-233	N-Linked / Undefined core		Hex:5 HexNAc:5 dHex:1 NeuAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Tryptase alpha/beta-1 / Homo sapiens Q15661 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:5 HexNAc:5 dHex:1 NeuAc:2 (avg mass : 2573.3611 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Tryptase alpha/beta-1 / Homo sapiens Asn-233 Mass spectrometry observed peptide VNGTWLQAGVVSWGEGCAQPNRPGIYTR (28aa) Q15661 Asn-233 Tryptase alpha/beta-1 / Homo sapiens
Asn-233	N-Linked / Undefined core		Hex:6 HexNAc:3 dHex:1 NeuAc:1	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Tryptase alpha/beta-1 / Homo sapiens Q15661 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:6 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 2037.8556 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Tryptase alpha/beta-1 / Homo sapiens Asn-233 Mass spectrometry observed peptide VNGTWLQAGVVSWGEGCAQPNRPGIYTR (28aa) Q15661 Asn-233 Tryptase alpha/beta-1 / Homo sapiens
Asn-233	N-Linked / Undefined core		Hex:3 HexNAc:2 dHex:1	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (2) Taxonomy Homo sapiens (Human) Protein Tryptase alpha/beta-1 / Homo sapiens Q15661 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:3 HexNAc:2 dHex:1 (avg mass : 1056.9755 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Tryptase alpha/beta-1 / Homo sapiens Asn-233 Mass spectrometry observed peptide VNGTWLQAGVVSWDEGCAQPNRPGIYTR (28aa) Q15661 Asn-233 Tryptase alpha/beta-1 / Homo sapiens VNGTWLQAGVVSWGEGCAQPNRPGIYTR (28aa) Q15661 Asn-233 Tryptase alpha/beta-1 / Homo sapiens
Asn-233	N-Linked / Undefined core		Hex:5 HexNAc:4 dHex:1 NeuAc:1	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Tryptase alpha/beta-1 / Homo sapiens Q15661 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:5 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 2078.9082 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Tryptase alpha/beta-1 / Homo sapiens Asn-233 Mass spectrometry observed peptide VNGTWLQAGVVSWGEGCAQPNRPGIYTR (28aa) Q15661 Asn-233 Tryptase alpha/beta-1 / Homo sapiens
Asn-233	N-Linked / Undefined core		Hex:12 HexNAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (2) peptide (2) Taxonomy Homo sapiens (Human) Protein Tryptase alpha/beta-1 / Homo sapiens Q15661 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:12 HexNAc:2 (avg mass : 2370.1141 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Tryptase alpha/beta-1 / Homo sapiens Asn-132 Asn-233 Mass spectrometry observed peptide VNGTWLQAGVVSWDEGCAQPNRPGIYTR (28aa) Q15661 Asn-233 Tryptase alpha/beta-1 / Homo sapiens VNGTWLQAGVVSWGEGCAQPNRPGIYTR (28aa) Q15661 Asn-233 Tryptase alpha/beta-1 / Homo sapiens
Asn-233	N-Linked / Undefined core		Hex:6 HexNAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Tryptase alpha/beta-1 / Homo sapiens Q15661 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:6 HexNAc:2 (avg mass : 1397.2597 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Tryptase alpha/beta-1 / Homo sapiens Asn-233 Mass spectrometry observed peptide VNGTWLQAGVVSWGEGCAQPNRPGIYTR (28aa) Q15661 Asn-233 Tryptase alpha/beta-1 / Homo sapiens
Asn-233	N-Linked / Undefined core		Hex:6 HexNAc:3 NeuAc:1	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Tryptase alpha/beta-1 / Homo sapiens Q15661 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:6 HexNAc:3 NeuAc:1 (avg mass : 1891.7126 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Tryptase alpha/beta-1 / Homo sapiens Asn-233 Mass spectrometry observed peptide VNGTWLQAGVVSWGEGCAQPNRPGIYTR (28aa) Q15661 Asn-233 Tryptase alpha/beta-1 / Homo sapiens
Asn-233	N-Linked / Undefined core		Hex:4 HexNAc:3 dHex:1 NeuAc:1	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (2) peptide (1) Taxonomy Homo sapiens (Human) Protein Tryptase alpha/beta-1 / Homo sapiens Q15661 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:4 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 1713.5708 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Tryptase alpha/beta-1 / Homo sapiens Asn-132 Asn-233 Mass spectrometry observed peptide VNGTWLQAGVVSWDEGCAQPNRPGIYTR (28aa) Q15661 Asn-233 Tryptase alpha/beta-1 / Homo sapiens
Asn-233	N-Linked / Undefined core		Hex:3 HexNAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (2) Taxonomy Homo sapiens (Human) Protein Tryptase alpha/beta-1 / Homo sapiens Q15661 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:3 HexNAc:2 (avg mass : 910.8325 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Tryptase alpha/beta-1 / Homo sapiens Asn-233 Mass spectrometry observed peptide VNGTWLQAGVVSWDEGCAQPNRPGIYTR (28aa) Q15661 Asn-233 Tryptase alpha/beta-1 / Homo sapiens VNGTWLQAGVVSWGEGCAQPNRPGIYTR (28aa) Q15661 Asn-233 Tryptase alpha/beta-1 / Homo sapiens
Asn-233	N-Linked / Undefined core		Hex:5 HexNAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Tryptase alpha/beta-1 / Homo sapiens Q15661 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:5 HexNAc:2 (avg mass : 1235.1173 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Tryptase alpha/beta-1 / Homo sapiens Asn-233 Mass spectrometry observed peptide VNGTWLQAGVVSWGEGCAQPNRPGIYTR (28aa) Q15661 Asn-233 Tryptase alpha/beta-1 / Homo sapiens

← Previous
Displaying 1 to 14 of 14
Next →

Show 50 per page