GlyConnect

Site	Core / Type	Cartoon	Composition	Biological associations
Asn-323	N-Linked / Undefined core		Hex:7 HexNAc:2	Taxonomy (1) Protein (1) Source (1) Structure (0) Composition (1) Disease (1) Reference (1) Site (1) Peptide (1) Taxonomy Homo sapiens (Human) Protein Serum paraoxonase/arylesterase 2 / Homo sapiens Q15165 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:7 HexNAc:2 (avg mass : 1559.4021 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serum paraoxonase/arylesterase 2 / Homo sapiens : Asn-323 Mass spectrometry validated peptide IQNIISEKPTVTTVYANNGSVIQGSSVASVYDGK (34aa) Q15165 Asn-323
Asn-323	N-Linked / Undefined core		Hex:3 HexNAc:6	Taxonomy (1) Protein (1) Source (1) Structure (0) Composition (1) Disease (1) Reference (1) Site (1) Peptide (1) Taxonomy Homo sapiens (Human) Protein Serum paraoxonase/arylesterase 2 / Homo sapiens Q15165 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:3 HexNAc:6 (avg mass : 1723.6125 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serum paraoxonase/arylesterase 2 / Homo sapiens : Asn-323 Mass spectrometry validated peptide IQNIISEKPTVTTVYANNGSVIQGSSVASVYDGK (34aa) Q15165 Asn-323
Asn-323	N-Linked / Undefined core		Hex:6 HexNAc:2	Taxonomy (1) Protein (1) Source (1) Structure (0) Composition (1) Disease (1) Reference (1) Site (1) Peptide (1) Taxonomy Homo sapiens (Human) Protein Serum paraoxonase/arylesterase 2 / Homo sapiens Q15165 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:6 HexNAc:2 (avg mass : 1397.2597 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serum paraoxonase/arylesterase 2 / Homo sapiens : Asn-323 Mass spectrometry validated peptide IQNIISEKPTVTTVYANNGSVIQGSSVASVYDGK (34aa) Q15165 Asn-323
Asn-323	N-Linked / Undefined core		Hex:9 HexNAc:2	Taxonomy (1) Protein (1) Source (1) Structure (0) Composition (1) Disease (1) Reference (1) Site (1) Peptide (1) Taxonomy Homo sapiens (Human) Protein Serum paraoxonase/arylesterase 2 / Homo sapiens Q15165 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:9 HexNAc:2 (avg mass : 1883.6869 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serum paraoxonase/arylesterase 2 / Homo sapiens : Asn-323 Mass spectrometry validated peptide IQNIISEKPTVTTVYANNGSVIQGSSVASVYDGK (34aa) Q15165 Asn-323
Asn-323	N-Linked / Undefined core		Hex:8 HexNAc:2	Taxonomy (1) Protein (1) Source (1) Structure (0) Composition (1) Disease (1) Reference (1) Site (1) Peptide (1) Taxonomy Homo sapiens (Human) Protein Serum paraoxonase/arylesterase 2 / Homo sapiens Q15165 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:8 HexNAc:2 (avg mass : 1721.5445 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Serum paraoxonase/arylesterase 2 / Homo sapiens : Asn-323 Mass spectrometry validated peptide IQNIISEKPTVTTVYANNGSVIQGSSVASVYDGK (34aa) Q15165 Asn-323

← Previous
Displaying 1 to 5 of 5
Next →

Show all