GlyConnect

Export CSV

Site	Core / Type	Cartoon	Composition	Biological associations
Asn-124	N-Linked / Undefined core		Hex:3 HexNAc:4 NeuAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Receptor tyrosine-protein kinase erbB-2 / Homo sapiens P04626 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:3 HexNAc:4 NeuAc:2 (avg mass : 1899.7383 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Receptor tyrosine-protein kinase erbB-2 / Homo sapiens Asn-124 Mass spectrometry observed peptide GTQLFEDNYALAVLDNGDPLNNTTPVTGASPGGLR (35aa) P04626 Asn-124 Receptor tyrosine-protein kinase erbB-2 / Homo sapiens
Asn-124	N-Linked / Undefined core		Hex:6 HexNAc:5 dHex:3	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Receptor tyrosine-protein kinase erbB-2 / Homo sapiens P04626 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:6 HexNAc:5 dHex:3 (avg mass : 2445.2737 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Receptor tyrosine-protein kinase erbB-2 / Homo sapiens Asn-124 Mass spectrometry observed peptide GTQLFEDNYALAVLDNGDPLNNTTPVTGASPGGLR (35aa) P04626 Asn-124 Receptor tyrosine-protein kinase erbB-2 / Homo sapiens
Asn-124	N-Linked / Undefined core		Hex:7 HexNAc:6 dHex:5	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Receptor tyrosine-protein kinase erbB-2 / Homo sapiens P04626 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:7 HexNAc:6 dHex:5 (avg mass : 3102.8971 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Receptor tyrosine-protein kinase erbB-2 / Homo sapiens Asn-124 Mass spectrometry observed peptide GTQLFEDNYALAVLDNGDPLNNTTPVTGASPGGLR (35aa) P04626 Asn-124 Receptor tyrosine-protein kinase erbB-2 / Homo sapiens

← Previous
Displaying 1 to 3 of 3
Next →

Show all