GlyConnect

Export CSV

Site	Core / Type	Cartoon	Composition	Biological associations
Asn-137	N-Linked / Undefined core		Hex:5 HexNAc:4 dHex:3	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Nectin-2 / Homo sapiens Q92692 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:5 HexNAc:4 dHex:3 (avg mass : 2079.9363 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Nectin-2 / Homo sapiens Asn-137 Mass spectrometry observed peptide QSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPK (38aa) Q92692 Asn-137 Nectin-2 / Homo sapiens
Asn-137	N-Linked / Undefined core		Hex:6 HexNAc:4 dHex:3	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Nectin-2 / Homo sapiens Q92692 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:6 HexNAc:4 dHex:3 (avg mass : 2242.0787 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Nectin-2 / Homo sapiens Asn-137 Mass spectrometry observed peptide QSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPK (38aa) Q92692 Asn-137 Nectin-2 / Homo sapiens

← Previous
Displaying 1 to 2 of 2
Next →

Show all