GlyConnect

Site	Core / Type	Cartoon	Composition	Biological associations
Asn-268	N-Linked / Undefined core		Hex:8 HexNAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (2) peptide (1) Taxonomy Homo sapiens (Human) Protein Mucin-6 / Homo sapiens Q6W4X9 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:8 HexNAc:2 (avg mass : 1721.5445 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Mucin-6 / Homo sapiens Asn-268 Asn-2366 Mass spectrometry observed peptide EPFVLSCQADVAAAPQPGPQNSSCATLSEYSR (32aa) Q6W4X9 Asn-268
Asn-902	N-Linked / Undefined core		Hex:6 HexNAc:5 dHex:3	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Mucin-6 / Homo sapiens Q6W4X9 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:6 HexNAc:5 dHex:3 (avg mass : 2445.2737 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Mucin-6 / Homo sapiens Asn-902 Mass spectrometry observed peptide FVFDGNCEYILATDVCGVNDSQPTFK (26aa) Q6W4X9 Asn-902
Asn-2366	N-Linked / Undefined core		Hex:6 HexNAc:5 dHex:1 NeuAc:3	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Mucin-6 / Homo sapiens Q6W4X9 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:6 HexNAc:5 dHex:1 NeuAc:3 (avg mass : 3026.7614 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Mucin-6 / Homo sapiens Asn-2366 Mass spectrometry observed peptide GCMANVTVTR (10aa) Q6W4X9 Asn-2366
Asn-2366	N-Linked / Undefined core		Hex:12 HexNAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Mucin-6 / Homo sapiens Q6W4X9 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:12 HexNAc:2 (avg mass : 2370.1141 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Mucin-6 / Homo sapiens Asn-2366 Mass spectrometry observed peptide GCMANVTVTR (10aa) Q6W4X9 Asn-2366
Asn-2366	N-Linked / Undefined core		Hex:8 HexNAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (2) peptide (1) Taxonomy Homo sapiens (Human) Protein Mucin-6 / Homo sapiens Q6W4X9 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:8 HexNAc:2 (avg mass : 1721.5445 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Mucin-6 / Homo sapiens Asn-268 Asn-2366 Mass spectrometry observed peptide GCMANVTVTR (10aa) Q6W4X9 Asn-2366
Asn-2366	N-Linked / Undefined core		Hex:5 HexNAc:4 dHex:3	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Mucin-6 / Homo sapiens Q6W4X9 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:5 HexNAc:4 dHex:3 (avg mass : 2079.9363 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Mucin-6 / Homo sapiens Asn-2366 Mass spectrometry observed peptide GCMANVTVTR (10aa) Q6W4X9 Asn-2366

← Previous
Displaying 1 to 6 of 6
Next →

Show all