GlyConnect

Export CSV

Site	Core / Type	Cartoon	Composition	Biological associations
Asn-50	N-Linked / Undefined core		Hex:7 HexNAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Integrin beta-1 / Homo sapiens P05556 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:7 HexNAc:2 (avg mass : 1559.4021 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Integrin beta-1 / Homo sapiens Asn-50 Mass spectrometry observed peptide SCGECIQAGPNCGWCTNSTFIQEGMPTSAR (30aa) P05556 Asn-50 Integrin beta-1 / Homo sapiens
Asn-50	N-Linked / Undefined core		Hex:3 HexNAc:6	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Integrin beta-1 / Homo sapiens P05556 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:3 HexNAc:6 (avg mass : 1723.6125 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Integrin beta-1 / Homo sapiens Asn-50 Mass spectrometry observed peptide SCGECIQAGPNCGWCTNSTFIQEGMPTSAR (30aa) P05556 Asn-50 Integrin beta-1 / Homo sapiens
Asn-50	N-Linked / Undefined core		Hex:6 HexNAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Integrin beta-1 / Homo sapiens P05556 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:6 HexNAc:2 (avg mass : 1397.2597 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Integrin beta-1 / Homo sapiens Asn-50 Mass spectrometry observed peptide SCGECIQAGPNCGWCTNSTFIQEGMPTSAR (30aa) P05556 Asn-50 Integrin beta-1 / Homo sapiens
Asn-50	N-Linked / Undefined core		Hex:9 HexNAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (2) Taxonomy Homo sapiens (Human) Protein Integrin beta-1 / Homo sapiens P05556 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:9 HexNAc:2 (avg mass : 1883.6869 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Integrin beta-1 / Homo sapiens Asn-50 Mass spectrometry observed peptide CGWCTNSTFLQEGMPTSAR (19aa) P05556 Asn-50 Integrin beta-1 / Homo sapiens SCGECIQAGPNCGWCTNSTFIQEGMPTSAR (30aa) P05556 Asn-50 Integrin beta-1 / Homo sapiens
Asn-50	N-Linked / Undefined core		Hex:8 HexNAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (2) Taxonomy Homo sapiens (Human) Protein Integrin beta-1 / Homo sapiens P05556 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:8 HexNAc:2 (avg mass : 1721.5445 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Integrin beta-1 / Homo sapiens Asn-50 Mass spectrometry observed peptide CGWCTNSTFLQEGMPTSAR (19aa) P05556 Asn-50 Integrin beta-1 / Homo sapiens SCGECIQAGPNCGWCTNSTFIQEGMPTSAR (30aa) P05556 Asn-50 Integrin beta-1 / Homo sapiens
Asn-50	N-Linked / Undefined core		Hex:6 HexNAc:5 dHex:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Integrin beta-1 / Homo sapiens P05556 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:6 HexNAc:5 dHex:2 (avg mass : 2299.1307 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Integrin beta-1 / Homo sapiens Asn-50 Mass spectrometry observed peptide SCGECIQAGPNCGWCTNSTFIQEGMPTSAR (30aa) P05556 Asn-50 Integrin beta-1 / Homo sapiens
Asn-50	N-Linked / Undefined core		Hex:7 HexNAc:6 dHex:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Integrin beta-1 / Homo sapiens P05556 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:7 HexNAc:6 dHex:2 (avg mass : 2664.4681 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Integrin beta-1 / Homo sapiens Asn-50 Mass spectrometry observed peptide SCGECIQAGPNCGWCTNSTFIQEGMPTSAR (30aa) P05556 Asn-50 Integrin beta-1 / Homo sapiens
Asn-50	N-Linked / Undefined core		Hex:7 HexNAc:6 dHex:4	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Integrin beta-1 / Homo sapiens P05556 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:7 HexNAc:6 dHex:4 (avg mass : 2956.7541 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Integrin beta-1 / Homo sapiens Asn-50 Mass spectrometry observed peptide SCGECIQAGPNCGWCTNSTFIQEGMPTSAR (30aa) P05556 Asn-50 Integrin beta-1 / Homo sapiens

← Previous
Displaying 1 to 8 of 8
Next →

Show all