GlyConnect

Site	Core / Type	Cartoon	Composition	Biological associations
Asn-242	N-Linked / Undefined core		Hex:8 HexNAc:2	Taxonomy (1) Protein (1) Source (1) Structure (0) Composition (1) Disease (1) Reference (1) Site (1) Peptide (1) Taxonomy Homo sapiens (Human) Protein Insulin receptor / Homo sapiens P06213 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:8 HexNAc:2 (avg mass : 1721.5445 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Insulin receptor / Homo sapiens : Asn-242 Mass spectrometry validated peptide SHGCTAEGICCHSECIGNCSQPDDPTK (27aa) P06213 Asn-242
Asn-424	N-Linked / Undefined core		Hex:6 HexNAc:5 dHex:3 NeuAc:1	Taxonomy (1) Protein (1) Source (1) Structure (0) Composition (1) Disease (1) Reference (1) Site (2) Peptide (1) Taxonomy Homo sapiens (Human) Protein Insulin receptor / Homo sapiens P06213 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:6 HexNAc:5 dHex:3 NeuAc:1 Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Insulin receptor / Homo sapiens : Asn-424 Asn-445 Mass spectrometry validated peptide GETIEIGNYSFYAIDNQNIR (20aa) P06213 Asn-424
Asn-424	N-Linked / Undefined core		Hex:8 HexNAc:7	Taxonomy (1) Protein (1) Source (1) Structure (0) Composition (1) Disease (1) Reference (1) Site (1) Peptide (1) Taxonomy Homo sapiens (Human) Protein Insulin receptor / Homo sapiens P06213 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:8 HexNAc:7 (avg mass : 2737.5195 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Insulin receptor / Homo sapiens : Asn-424 Mass spectrometry validated peptide GETIEIGNYSFYAIDNQNIR (20aa) P06213 Asn-424
Asn-445	N-Linked / Undefined core		Hex:6 HexNAc:5 dHex:1 NeuAc:1	Taxonomy (1) Protein (1) Source (1) Structure (0) Composition (1) Disease (1) Reference (1) Site (1) Peptide (1) Taxonomy Homo sapiens (Human) Protein Insulin receptor / Homo sapiens P06213 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:6 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2444.2456 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Insulin receptor / Homo sapiens : Asn-445 Mass spectrometry validated peptide HNLTITQGK (9aa) P06213 Asn-445
Asn-445	N-Linked / Undefined core		Hex:6 HexNAc:5 dHex:3 NeuAc:1	Taxonomy (1) Protein (1) Source (1) Structure (0) Composition (1) Disease (1) Reference (1) Site (2) Peptide (1) Taxonomy Homo sapiens (Human) Protein Insulin receptor / Homo sapiens P06213 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:6 HexNAc:5 dHex:3 NeuAc:1 Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Insulin receptor / Homo sapiens : Asn-424 Asn-445 Mass spectrometry validated peptide HNLTITQGK (9aa) P06213 Asn-445
Asn-445	N-Linked / Undefined core		Hex:6 HexNAc:5 dHex:3	Taxonomy (1) Protein (1) Source (1) Structure (0) Composition (1) Disease (1) Reference (1) Site (2) Peptide (1) Taxonomy Homo sapiens (Human) Protein Insulin receptor / Homo sapiens P06213 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:6 HexNAc:5 dHex:3 (avg mass : 2445.2737 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Insulin receptor / Homo sapiens : Asn-445 Asn-633 Mass spectrometry validated peptide HNLTITQGK (9aa) P06213 Asn-445
Asn-541	N-Linked / Undefined core		Hex:7 HexNAc:2	Taxonomy (1) Protein (1) Source (1) Structure (0) Composition (1) Disease (1) Reference (1) Site (1) Peptide (1) Taxonomy Homo sapiens (Human) Protein Insulin receptor / Homo sapiens P06213 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:7 HexNAc:2 (avg mass : 1559.4021 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Insulin receptor / Homo sapiens : Asn-541 Mass spectrometry validated peptide EAPYQNVTEFDGQDACGSNSWTVVDIDPPLR (31aa) P06213 Asn-541
Asn-633	N-Linked / Undefined core		Hex:6 HexNAc:5 dHex:3	Taxonomy (1) Protein (1) Source (1) Structure (0) Composition (1) Disease (1) Reference (1) Site (2) Peptide (1) Taxonomy Homo sapiens (Human) Protein Insulin receptor / Homo sapiens P06213 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:6 HexNAc:5 dHex:3 (avg mass : 2445.2737 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Insulin receptor / Homo sapiens : Asn-445 Asn-633 Mass spectrometry validated peptide SDIIYVQTDATNPSVPLDPISVSNSSSQIILK (32aa) P06213 Asn-633
Asn-920	N-Linked / Undefined core		Hex:6 HexNAc:3 NeuAc:1	Taxonomy (1) Protein (1) Source (1) Structure (0) Composition (1) Disease (1) Reference (1) Site (1) Peptide (1) Taxonomy Homo sapiens (Human) Protein Insulin receptor / Homo sapiens P06213 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:6 HexNAc:3 NeuAc:1 (avg mass : 1891.7126 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Insulin receptor / Homo sapiens : Asn-920 Mass spectrometry validated peptide GISPGNYSVR (10aa) P06213 Asn-920
Asn-920	N-Linked / Undefined core		Hex:6 HexNAc:3 dHex:3	Taxonomy (1) Protein (1) Source (1) Structure (0) Composition (1) Disease (1) Reference (1) Site (1) Peptide (1) Taxonomy Homo sapiens (Human) Protein Insulin receptor / Homo sapiens P06213 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:6 HexNAc:3 dHex:3 Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Insulin receptor / Homo sapiens : Asn-920 Mass spectrometry validated peptide GISPGNYSVR (10aa) P06213 Asn-920

← Previous
Displaying 1 to 10 of 10
Next →

Show all