Insulin-like growth factor-binding protein complex acid labile subunit

Taxonomy

• Homo sapiens (Human)

Protein

• Insulin-like growth factor-binding protein complex acid labile subunit / Homo sapiens    P35858

Source

• Blood Serum (UBERON_0001977)  
• Mammary Gland (UBERON_0001911)  

Reported structure

Composition

• Hex:5 HexNAc:4 NeuAc:1 (avg mass : 1932.7652 )
• Hex:5 HexNAc:4 NeuAc:2 (avg mass : 2224.0231 )
• Hex:5 HexNAc:4 dHex:2 NeuAc:1 (avg mass : 2225.0512 )
• Hex:6 HexNAc:5 NeuAc:3 (avg mass : 2880.6184 )
• Hex:6 HexNAc:6 NeuAc:3 (avg mass : 3083.8134 )
• Hex:7 HexNAc:6 NeuAc:2 (avg mass : 2954.6979 )
• Hex:9 HexNAc:2 (avg mass : 1883.6869 )

Disease

• Cancer, breast (DOID:1612)
• Prostate cancer (DOID:10283)

Reference

• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed

Reported glycosite

• Insulin-like growth factor-binding protein complex acid labile subunit / Homo sapiens
  •        Asn-368
  •        Asn-580

Mass spectrometry observed peptide

• AGAFLGLTNVAVMNLSGNCLR (21aa)
  •    P35858    Asn-368     Insulin-like growth factor-binding protein complex acid labile subunit / Homo sapiens
• FVQAICEGDDCQPPAYTYNNITCASPPEVVGIDIR (35aa)
  •    P35858    Asn-580     Insulin-like growth factor-binding protein complex acid labile subunit / Homo sapiens