GlyConnect

Export CSV

Site	Core / Type	Cartoon	Composition	Biological associations
Asn-201	N-Linked / Undefined core		Hex:6 HexNAc:4 dHex:1 NeuAc:1	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Fibromodulin / Homo sapiens Q06828 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:6 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 2241.0506 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Fibromodulin / Homo sapiens Asn-201 Mass spectrometry observed peptide VPNNAIEGIENITAIYIQHNEIQEVGSSMR (30aa) Q06828 Asn-201 Fibromodulin / Homo sapiens
Asn-201	N-Linked / Undefined core		Hex:12 HexNAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Fibromodulin / Homo sapiens Q06828 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:12 HexNAc:2 (avg mass : 2370.1141 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Fibromodulin / Homo sapiens Asn-201 Mass spectrometry observed peptide VPNNAIEGIENITAIYIQHNEIQEVGSSMR (30aa) Q06828 Asn-201 Fibromodulin / Homo sapiens
Asn-201	N-Linked / Undefined core		Hex:5 HexNAc:6 dHex:1 NeuAc:1	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Fibromodulin / Homo sapiens Q06828 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:5 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2485.2982 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Fibromodulin / Homo sapiens Asn-201 Mass spectrometry observed peptide VPNNAIEGIENITAIYIQHNEIQEVGSSMR (30aa) Q06828 Asn-201 Fibromodulin / Homo sapiens
Asn-201	N-Linked / Undefined core		Hex:3 HexNAc:9 dHex:1	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Fibromodulin / Homo sapiens Q06828 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:3 HexNAc:9 dHex:1 (avg mass : 2479.3405 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Fibromodulin / Homo sapiens Asn-201 Mass spectrometry observed peptide VPNNAIEGIENITAIYIQHNEIQEVGSSMR (30aa) Q06828 Asn-201 Fibromodulin / Homo sapiens
Asn-201	N-Linked / Undefined core		Hex:3 HexNAc:6 dHex:3	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Fibromodulin / Homo sapiens Q06828 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:3 HexNAc:6 dHex:3 (avg mass : 2162.0415 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Fibromodulin / Homo sapiens Asn-201 Mass spectrometry observed peptide VPNNAIEGIENITAIYIQHNEIQEVGSSMR (30aa) Q06828 Asn-201 Fibromodulin / Homo sapiens

← Previous
Displaying 1 to 5 of 5
Next →

Show all