GlyConnect

Site	Core / Type	Cartoon	Composition	Biological associations
Asn-201	N-Linked / Undefined core		Hex:12 HexNAc:2	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Fibromodulin / Homo sapiens : Asn-201 (1 structure) Mass spectrometry validated peptide VPNNAIEGIENITAIYIQHNEIQEVGSSMR (30aa) Q06828 Asn-201
Asn-201	N-Linked / Undefined core		Hex:6 HexNAc:4 dHex:1 NeuAc:1	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Fibromodulin / Homo sapiens : Asn-201 (1 structure) Mass spectrometry validated peptide VPNNAIEGIENITAIYIQHNEIQEVGSSMR (30aa) Q06828 Asn-201
Asn-201	N-Linked / Undefined core		Hex:5 HexNAc:6 dHex:1 NeuAc:1	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Fibromodulin / Homo sapiens : Asn-201 (1 structure) Mass spectrometry validated peptide VPNNAIEGIENITAIYIQHNEIQEVGSSMR (30aa) Q06828 Asn-201
Asn-201	N-Linked / Undefined core		Hex:3 HexNAc:9 dHex:1	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Fibromodulin / Homo sapiens : Asn-201 (1 structure) Mass spectrometry validated peptide VPNNAIEGIENITAIYIQHNEIQEVGSSMR (30aa) Q06828 Asn-201
Asn-201	N-Linked / Undefined core		Hex:3 HexNAc:6 dHex:3	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Fibromodulin / Homo sapiens : Asn-201 (1 structure) Mass spectrometry validated peptide VPNNAIEGIENITAIYIQHNEIQEVGSSMR (30aa) Q06828 Asn-201

← Previous
Displaying 1 to 5 of 5
Next →

Show 50 per page