GlyConnect

Site	Core / Type	Cartoon	Composition	Biological associations
Asn-201	N-Linked / Undefined core		Hex:6 HexNAc:4 dHex:1 NeuAc:1	Taxonomy (1) Protein (1) Source (1) Structure (0) Composition (1) Disease (1) Reference (1) Site (1) Peptide (1) Taxonomy Homo sapiens (Human) Protein Fibromodulin / Homo sapiens Q06828 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:6 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 2241.0506 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Fibromodulin / Homo sapiens : Asn-201 Mass spectrometry validated peptide VPNNAIEGIENITAIYIQHNEIQEVGSSMR (30aa) Q06828 Asn-201
Asn-201	N-Linked / Undefined core		Hex:12 HexNAc:2	Taxonomy (1) Protein (1) Source (1) Structure (0) Composition (1) Disease (1) Reference (1) Site (1) Peptide (1) Taxonomy Homo sapiens (Human) Protein Fibromodulin / Homo sapiens Q06828 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:12 HexNAc:2 (avg mass : 2370.1141 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Fibromodulin / Homo sapiens : Asn-201 Mass spectrometry validated peptide VPNNAIEGIENITAIYIQHNEIQEVGSSMR (30aa) Q06828 Asn-201
Asn-201	N-Linked / Undefined core		Hex:5 HexNAc:6 dHex:1 NeuAc:1	Taxonomy (1) Protein (1) Source (1) Structure (0) Composition (1) Disease (1) Reference (1) Site (1) Peptide (1) Taxonomy Homo sapiens (Human) Protein Fibromodulin / Homo sapiens Q06828 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:5 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2485.2982 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Fibromodulin / Homo sapiens : Asn-201 Mass spectrometry validated peptide VPNNAIEGIENITAIYIQHNEIQEVGSSMR (30aa) Q06828 Asn-201
Asn-201	N-Linked / Undefined core		Hex:3 HexNAc:9 dHex:1	Taxonomy (1) Protein (1) Source (1) Structure (0) Composition (1) Disease (1) Reference (1) Site (1) Peptide (1) Taxonomy Homo sapiens (Human) Protein Fibromodulin / Homo sapiens Q06828 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:3 HexNAc:9 dHex:1 (avg mass : 2479.3405 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Fibromodulin / Homo sapiens : Asn-201 Mass spectrometry validated peptide VPNNAIEGIENITAIYIQHNEIQEVGSSMR (30aa) Q06828 Asn-201
Asn-201	N-Linked / Undefined core		Hex:3 HexNAc:6 dHex:3	Taxonomy (1) Protein (1) Source (1) Structure (0) Composition (1) Disease (1) Reference (1) Site (1) Peptide (1) Taxonomy Homo sapiens (Human) Protein Fibromodulin / Homo sapiens Q06828 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:3 HexNAc:6 dHex:3 (avg mass : 2162.0415 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Fibromodulin / Homo sapiens : Asn-201 Mass spectrometry validated peptide VPNNAIEGIENITAIYIQHNEIQEVGSSMR (30aa) Q06828 Asn-201

← Previous
Displaying 1 to 5 of 5
Next →

Show all