GlyConnect

Site	Core / Type	Cartoon	Composition	Biological associations
Asn-299	N-Linked / Undefined core		Hex:4 HexNAc:4 dHex:1	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Homo sapiens P04843 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:4 HexNAc:4 dHex:1 (avg mass : 1625.5079 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Homo sapiens Asn-299 Mass spectrometry observed peptide DEIGNVSTSHIIIIDDSVEMEIRPR (25aa) P04843 Asn-299
Asn-299	N-Linked / Undefined core		Hex:7 HexNAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Homo sapiens P04843 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:7 HexNAc:2 (avg mass : 1559.4021 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Homo sapiens Asn-299 Mass spectrometry observed peptide TIIPAAAQDVYYRDEIGNVSTSHIIIIDDSVEMEIRPR (38aa) P04843 Asn-299
Asn-299	N-Linked / Undefined core		Hex:6 HexNAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Homo sapiens P04843 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:6 HexNAc:2 (avg mass : 1397.2597 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Homo sapiens Asn-299 Mass spectrometry observed peptide TIIPAAAQDVYYRDEIGNVSTSHIIIIDDSVEMEIRPR (38aa) P04843 Asn-299
Asn-299	N-Linked / Undefined core		Hex:9 HexNAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Homo sapiens P04843 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:9 HexNAc:2 (avg mass : 1883.6869 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Homo sapiens Asn-299 Mass spectrometry observed peptide DEIGNVSTSH (10aa) P04843 Asn-299
Asn-299	N-Linked / Undefined core		Hex:4 HexNAc:6	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Homo sapiens P04843 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:4 HexNAc:6 (avg mass : 1885.7549 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Homo sapiens Asn-299 Mass spectrometry observed peptide DEIGNVSTSH (10aa) P04843 Asn-299

← Previous
Displaying 1 to 5 of 5
Next →

Show all