GlyConnect

Site	Core / Type	Cartoon	Composition	Biological associations
Asn-134	N-Linked / Undefined core		Hex:5 HexNAc:4 NeuAc:2	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Cathepsin D / Homo sapiens : Asn-134 (1 structure) Mass spectrometry validated peptide NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa) P07339 Asn-134
Asn-134	N-Linked / Undefined core		Hex:3 HexNAc:2 dHex:1	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Cathepsin D / Homo sapiens : Asn-134 (1 structure) Mass spectrometry validated peptide NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa) P07339 Asn-134
Asn-134	N-Linked / Undefined core		Hex:5 HexNAc:4 dHex:1 NeuAc:1	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Cathepsin D / Homo sapiens : Asn-134 (1 structure) Mass spectrometry validated peptide NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa) P07339 Asn-134
Asn-134	N-Linked / Undefined core		Hex:6 HexNAc:3	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Cathepsin D / Homo sapiens : Asn-134 (1 structure) Mass spectrometry validated peptide NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa) P07339 Asn-134
Asn-134	N-Linked / Undefined core		Hex:5 HexNAc:4	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Cathepsin D / Homo sapiens : Asn-134 (1 structure) Mass spectrometry validated peptide NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa) P07339 Asn-134
Asn-134	N-Linked / Undefined core		Hex:6 HexNAc:2	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (5) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Cathepsin D / Homo sapiens : Asn-134 (1 structure) Mass spectrometry validated peptide NGTSFDIHYGSGSL (14aa) P07339 Asn-134 NGTSFDIHY (9aa) P07339 Asn-134 NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa) P07339 Asn-134 NGTSFDIHYGSGSLSGYLSQD (21aa) P07339 Asn-134 NGTSFDIHYG (10aa) P07339 Asn-134
Asn-134	N-Linked / Undefined core		Hex:5 HexNAc:3 NeuAc:1	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Cathepsin D / Homo sapiens : Asn-134 (1 structure) Mass spectrometry validated peptide NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa) P07339 Asn-134
Asn-134	N-Linked / Undefined core		Hex:3 HexNAc:2	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (3) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Cathepsin D / Homo sapiens : Asn-134 (1 structure) Mass spectrometry validated peptide NGTSFDIHYGSGSL (14aa) P07339 Asn-134 NGTSFDIHY (9aa) P07339 Asn-134 NGTSFDIHYG (10aa) P07339 Asn-134
Asn-134	N-Linked / Undefined core		Hex:5 HexNAc:2	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Cathepsin D / Homo sapiens : Asn-134 (1 structure) Mass spectrometry validated peptide NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa) P07339 Asn-134
Asn-134	N-Linked / Undefined core		Hex:4 HexNAc:3 dHex:1	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Cathepsin D / Homo sapiens : Asn-134 (1 structure) Mass spectrometry validated peptide NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa) P07339 Asn-134
Asn-134	N-Linked / Undefined core		Hex:7 HexNAc:6	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Cathepsin D / Homo sapiens : Asn-134 (1 structure) Mass spectrometry validated peptide NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa) P07339 Asn-134
Asn-134	N-Linked / Undefined core		Hex:3 HexNAc:6 dHex:1	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Cathepsin D / Homo sapiens : Asn-134 (1 structure) Mass spectrometry validated peptide NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa) P07339 Asn-134
Asn-134	N-Linked / Undefined core		Hex:3 HexNAc:8	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Cathepsin D / Homo sapiens : Asn-134 (1 structure) Mass spectrometry validated peptide NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa) P07339 Asn-134
Asn-134	N-Linked / Undefined core		Hex:3 HexNAc:8 dHex:1	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (1) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Cathepsin D / Homo sapiens : Asn-134 (1 structure) Mass spectrometry validated peptide NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa) P07339 Asn-134
Asn-134	N-Linked / Undefined core		Hex:7 HexNAc:2	Tissue (1) Disease (1) Reference (1) Site (1) Peptide (2) Tissue Exocrine System > Exocrine Gland > Mammary > Primary or metastatic breast tumors Disease Cancer, breast Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Cathepsin D / Homo sapiens : Asn-134 (1 structure) Mass spectrometry validated peptide NGTSFDIHY (9aa) P07339 Asn-134 NGTSFDIHYGSGSLSGYLSQDTVSVPCQS (29aa) P07339 Asn-134

← Previous
Displaying 1 to 15 of 15
Next →

Show 50 per page