GlyConnect

Site	Core / Type	Cartoon	Composition	Biological associations
Asn-134	N-Linked / Undefined core		Hex:4 HexNAc:3 dHex:1	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Cathepsin D / Homo sapiens P07339 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:4 HexNAc:3 dHex:1 (avg mass : 1422.3129 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Cathepsin D / Homo sapiens Asn-134 Mass spectrometry observed peptide NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa) P07339 Asn-134
Asn-134	N-Linked / Undefined core		Hex:7 HexNAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (2) Taxonomy Homo sapiens (Human) Protein Cathepsin D / Homo sapiens P07339 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:7 HexNAc:2 (avg mass : 1559.4021 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Cathepsin D / Homo sapiens Asn-134 Mass spectrometry observed peptide NGTSFDIHYGSGSLSGYLSQDTVSVPCQS (29aa) P07339 Asn-134 NGTSFDIHY (9aa) P07339 Asn-134
Asn-134	N-Linked / Undefined core		Hex:5 HexNAc:4 NeuAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Cathepsin D / Homo sapiens P07339 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:5 HexNAc:4 NeuAc:2 (avg mass : 2224.0231 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Cathepsin D / Homo sapiens Asn-134 Mass spectrometry observed peptide NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa) P07339 Asn-134
Asn-134	N-Linked / Undefined core		Hex:3 HexNAc:2 dHex:1	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Cathepsin D / Homo sapiens P07339 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:3 HexNAc:2 dHex:1 (avg mass : 1056.9755 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Cathepsin D / Homo sapiens Asn-134 Mass spectrometry observed peptide NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa) P07339 Asn-134
Asn-134	N-Linked / Undefined core		Hex:5 HexNAc:4 dHex:1 NeuAc:1	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Cathepsin D / Homo sapiens P07339 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:5 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 2078.9082 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Cathepsin D / Homo sapiens Asn-134 Mass spectrometry observed peptide NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa) P07339 Asn-134
Asn-134	N-Linked / Undefined core		Hex:6 HexNAc:3	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Cathepsin D / Homo sapiens P07339 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:6 HexNAc:3 (avg mass : 1600.4547 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Cathepsin D / Homo sapiens Asn-134 Mass spectrometry observed peptide NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa) P07339 Asn-134
Asn-134	N-Linked / Undefined core		Hex:5 HexNAc:4	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Cathepsin D / Homo sapiens P07339 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:5 HexNAc:4 (avg mass : 1641.5073 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Cathepsin D / Homo sapiens Asn-134 Mass spectrometry observed peptide NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa) P07339 Asn-134
Asn-134	N-Linked / Undefined core		Hex:6 HexNAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (5) Taxonomy Homo sapiens (Human) Protein Cathepsin D / Homo sapiens P07339 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:6 HexNAc:2 (avg mass : 1397.2597 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Cathepsin D / Homo sapiens Asn-134 Mass spectrometry observed peptide NGTSFDIHYG (10aa) P07339 Asn-134 NGTSFDIHY (9aa) P07339 Asn-134 NGTSFDIHYGSGSLSGYLSQD (21aa) P07339 Asn-134 NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa) P07339 Asn-134 NGTSFDIHYGSGSL (14aa) P07339 Asn-134
Asn-134	N-Linked / Undefined core		Hex:5 HexNAc:3 NeuAc:1	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Cathepsin D / Homo sapiens P07339 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:5 HexNAc:3 NeuAc:1 (avg mass : 1729.5702 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Cathepsin D / Homo sapiens Asn-134 Mass spectrometry observed peptide NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa) P07339 Asn-134
Asn-134	N-Linked / Undefined core		Hex:3 HexNAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (3) Taxonomy Homo sapiens (Human) Protein Cathepsin D / Homo sapiens P07339 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:3 HexNAc:2 (avg mass : 910.8325 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Cathepsin D / Homo sapiens Asn-134 Mass spectrometry observed peptide NGTSFDIHYG (10aa) P07339 Asn-134 NGTSFDIHY (9aa) P07339 Asn-134 NGTSFDIHYGSGSL (14aa) P07339 Asn-134
Asn-134	N-Linked / Undefined core		Hex:5 HexNAc:2	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Cathepsin D / Homo sapiens P07339 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:5 HexNAc:2 (avg mass : 1235.1173 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Cathepsin D / Homo sapiens Asn-134 Mass spectrometry observed peptide NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa) P07339 Asn-134
Asn-134	N-Linked / Undefined core		Hex:7 HexNAc:6	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Cathepsin D / Homo sapiens P07339 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:7 HexNAc:6 (avg mass : 2372.1821 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Cathepsin D / Homo sapiens Asn-134 Mass spectrometry observed peptide NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa) P07339 Asn-134
Asn-134	N-Linked / Undefined core		Hex:3 HexNAc:6 dHex:1	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Cathepsin D / Homo sapiens P07339 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:3 HexNAc:6 dHex:1 (avg mass : 1869.7555 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Cathepsin D / Homo sapiens Asn-134 Mass spectrometry observed peptide NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa) P07339 Asn-134
Asn-134	N-Linked / Undefined core		Hex:3 HexNAc:8	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Cathepsin D / Homo sapiens P07339 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:3 HexNAc:8 (avg mass : 2130.0025 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Cathepsin D / Homo sapiens Asn-134 Mass spectrometry observed peptide NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa) P07339 Asn-134
Asn-134	N-Linked / Undefined core		Hex:3 HexNAc:8 dHex:1	taxonomy (1) protein (1) source (1) structure (0) composition (1) disease (1) reference (1) site (1) peptide (1) Taxonomy Homo sapiens (Human) Protein Cathepsin D / Homo sapiens P07339 Source Mammary Gland (UBERON_0001911) Reported structure Composition Hex:3 HexNAc:8 dHex:1 (avg mass : 2276.1455 ) Disease Cancer, breast (DOID:1612) Reference Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed Reported glycosite Cathepsin D / Homo sapiens Asn-134 Mass spectrometry observed peptide NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa) P07339 Asn-134

← Previous
Displaying 1 to 15 of 15
Next →

Show all