• GlyConnect
  •     |    
  • Search
  •     |    
  • Browse :
  • Structures
  • Compositions
  • Proteins
  • Tissues
  • Taxonomy
  • Diseases
  • References
  • Help
  • Contact
  • GlyConnect >
  • GlycoProteins >
  • All-trans retinoic acid-induced differentiation factor

All-trans retinoic acid-induced differentiation factor

Taxonomy : Homo sapiens

SNFG, Text, Oxford
Taxonomy (1) Protein (1) Source (1) Structure (0) Composition (4) Disease (1) Site (2) Peptide (2)

    Taxonomy

  • Homo sapiens (Human)

    Protein

  • All-trans retinoic acid-induced differentiation factor / Homo sapiens    Q6UW56

    Source

  • Mammary Gland (UBERON_0001911)  

    Reported structure

    Composition

  • Hex:6 HexNAc:2 (avg mass : 1397.2597 )
  • Hex:4 HexNAc:3 dHex:3
  • Hex:3 HexNAc:6 (avg mass : 1723.6125 )
  • Hex:8 HexNAc:2 (avg mass : 1721.5445 )

    Disease

  • Cancer, breast (DOID:1612)

    Reported glycosite

  • All-trans retinoic acid-induced differentiation factor / Homo sapiens :
    •        Asn-44
    •        Asn-157

    Mass spectrometry validated peptide

  • LPEICTQCPGSVQNLSK (17aa)
    •    Q6UW56    Asn-44
  • NLCNNTGDPEMCPENGSCVPDGPGLLQCVCADGFHGYK (38aa)
    •    Q6UW56    Asn-157
  • 3 x 6 x
    • Hex:3 HexNAc:6 (avg mass : 1723.6125 )
    • Site (1) Suggested Structure (0)

        Suggested structure

        Reported glycosite

      • All-trans retinoic acid-induced differentiation factor / Homo sapiens :
        •        Asn-44
  • 8 x 2 x
    • Hex:8 HexNAc:2 (avg mass : 1721.5445 )
    • Site (1) Suggested Structure (0)

        Suggested structure

        Reported glycosite

      • All-trans retinoic acid-induced differentiation factor / Homo sapiens :
        •        Asn-44
  • 4 x 3 x 3 x
    • Hex:4 HexNAc:3 dHex:3
    • Site (1) Suggested Structure (0)

        Suggested structure

        Reported glycosite

      • All-trans retinoic acid-induced differentiation factor / Homo sapiens :
        •        Asn-44
  • 6 x 2 x
    • Hex:6 HexNAc:2 (avg mass : 1397.2597 )
    • Site (2) Suggested Structure (0)

        Suggested structure

        Reported glycosite

      • All-trans retinoic acid-induced differentiation factor / Homo sapiens :
        •        Asn-44
        •        Asn-157

Protein and gene references

UniProtKB : Q6UW56

neXtProt : NX_Q6UW56

GeneCards : ATRAID

3D structure from PDB

Either no PDB or existing PDB of non-glycosylated form

References (1)

Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018)
Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang
Pubmed : 29741879   DOI : 10.1021/acs.analchem.8b01137
Status : Unreviewed

GlyConnect Creative Commons License

Supported by SIB ExPASy