Id Sequence Length Biological associations
102 SGLAPNPTNATTK 13

    Reported structure

103 NVTGFTGR 8

    Reported structure

104 TPPVVNVTW 9

    Reported structure

105 NETHFDAGAK 10

    Reported structure

106 VNGSLDR 7

    Reported structure

107 NDGMNITVLR 10

    Reported structure

108 YPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVR 42

    Reported structure

109 VVIGANGTYSCIVR 14

    Reported structure

110 FFNFSWR 7

    Reported structure

111 ADEEEVPEEWVLLHVVQGQIGAGNYSYLR 29

    Reported structure

112 IIDGDITSDPSYFQNVTGCSNYYNFIR 27

    Reported structure

113 EIHHIQEQNVSNAFIDKGEFYIGSK 25

    Reported structure

114 NVTDPTCPSLSPGVSQCFPDCVCEDAYNNTYACVR 35

    Reported structure

115 NGSEYFVK 8

    Protein

  • Mesothelin / Homo sapiens    Q13421

    Reported structure

116 NILDALMLNTTR 12

    Reported structure

117 YHNQTIR 7

    Reported structure

118 NHTYNTY 7

    Reported structure

119 YTGNASALFILPDQDK 16

    Reported structure

120 ELPGVCNETMMALWEECK 18

    Protein

  • Clusterin / Homo sapiens    P10909

    Reported structure

121 AFGQFFSPGEVIYNKTDR 18

    Protein

  • Mucin-5B / Homo sapiens    Q9HC84

    Reported structure

122 IINGSNK 7

    Reported structure

123 AFNTTK 6

    Reported structure

124 SCINESAIDSR 11
125 VDVAMPLNFTGGQLHSR 17

    Reported structure

126 CFILPNDSIHCER 13

    Reported structure

127 NFTAADWGQSR 11

    Reported structure

128 INAINITSAIDR 12

    Reported structure

129 QVAIQTFGNQTTIIPAGGAGYK 22

    Reported structure

130 RPPGLEYCYNPSHNPEEQLSSK 22

    Reported structure

131 LQAPLNYTEFQK 12

    Reported structure

132 ISVMVNNGSLSYDHSK 16

    Reported structure

133 MSVCTDNVTDLR 12

    Reported structure

134 IYNQNVSQK 9

    Reported structure

135 HNGTVECK 8

    Reported structure

136 LQNNFITELPVESFQNATGLR 21

    Protein

  • Prolargin / Homo sapiens    P51888

    Reported structure

137 FINYNQTVSR 10

    Reported structure

138 IPNNTQWVTWSPVGHK 16

    Reported structure

139 PANVSFVLVPFK 12

    Reported structure

140 NSSGVEER 8

    Reported structure

141 GSQWSDIEEFCNR 13

    Reported structure

142 VSAITLVSATSTTANMTVGPEGK 23

    Reported structure

143 IAPASNVSHTVVLRPL 16

    Reported structure

144 ITYSIVQTNCSK 12

    Reported structure

145 AIAGIVYNASGSEHCYDIYR 20

    Reported structure

146 DENESPIPCFLAGDHR 16

    Reported structure

147 YNLSSER 7

    Reported structure

148 NCGVNCSGDVFTALIGEIASPNYPK 25

    Reported structure

149 SVVAPATDGGINITSTFIR 19

    Reported structure

150 IETVIPAEFFEVISSSQNGSYHR 23

    Reported structure

151 GHEVEDVDIEIFNTSVQIQPPTTAPGPETAAFIER 35

    Reported structure